(data stored in ACNUC7421 zone)

EMBL: CP002047.PE616

CP002047.PE616       Location/Qualifiers
FT   CDS_pept        complement(783817..786099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00616"
FT                   /product="membrane transport protein"
FT                   /note="COG2409 Predicted drug exporters of the RND
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03737"
FT                   /db_xref="GOA:D7C283"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D7C283"
FT                   /protein_id="ADI03737.1"
FT                   /translation="MATFLYRIGRWAFRRRRLVGGLWLGVLVLAVVAAAMAPEGKEEDL
FT                   SMPGTESQKAFDLLDERFPQSNSQGAEARLVFRAPDGQRVTARENKAAVENTLGSLDGG
FT                   DQVASTTDPYETGAVSEDGTIAYSTITYTADAVDLAEPTKSALEDAASQARDAGLTVEI
FT                   GGSALDSEEEPGGTTEIIGVAVAAVVLVLALGSLVAAGLSLLTAFVGVAIAFGLVSALA
FT                   VPLGLTSTVAILALMLGLAVGIDYALFITSRFRDERAQGSEPEEAAGRAVGTAGSAVVF
FT                   AGATVFIALVGLGVVGIPELTKMGMGGAGAVALAVLVALTLVPALFGFFGRRVLSRAVR
FT                   KEPSYRRSGSERPGSERPHPVPTAAGRPGLGTRWARFVLRRPAAVLLIAGLGLGAVALP
FT                   ALSLELGLPGDESKSVETTQRRAYDLLSEGFGPGFNGPLTLVVDMPASSGSGDTRATTD
FT                   LVAKTVRGVDGVASVGDPVLSRGKDTAVLTAVPQTAPNSGETKDLVHAIRGAVSGVEAD
FT                   TGADILVTGTTAMNIDISEAMSDALVPYLTVVIGLAVLLLMVVFRSVLVPVKAALGFLL
FT                   SVGAAFGVLVAVFQWGWAADLIGIEQTGPVMSLMPILIIGIVFGLAMDYEVFLLTRMRE
FT                   AYVHGASPGEAIVNGFRHSGRVVAAAAIIMISVFAGFIGMSSPTIQTMGVGLAAAVAFD
FT                   AFVVRMAIAPAVLALLGHRAWWLPRILNRVLPNVDIEGEKLSRHVPASAAELDAAVPRL
FT                   PVGRHRH"
     gtggcgacat ttctttaccg gatcggacgg tgggccttcc ggcgccgccg gctcgtgggt        60
     ggtctgtggt tgggtgtcct ggtgctggcc gtcgtcgccg ccgccatggc gccggagggg       120
     aaggaagagg acctctccat gcccggcacc gagtcgcaga aggcgttcga tctgctggac       180
     gagcgcttcc cccagagcaa ctcccaaggg gccgaggccc gcttggtgtt ccgggccccg       240
     gacgggcagc gggtgacggc cagggagaac aaggcggccg tcgagaacac gctcggctcg       300
     ctggacgggg gcgatcaggt cgcgtcgacc accgacccct atgagaccgg tgctgtcagc       360
     gaggacggca ccatcgccta ctccacgatc acctacaccg cggacgccgt cgacctggcc       420
     gagccgacga agagcgccct cgaggacgcc gcgagccagg cccgggacgc ggggttgacc       480
     gtggagatcg gcggctcggc cctggattcg gaagaggaac cgggcggtac gacggagatc       540
     atcggcgtgg cggtggcggc ggtggtgctg gtcctcgccc tcgggtcgct ggtcgcggcc       600
     ggattgtcgc tgctgaccgc cttcgtgggc gtggccatcg ccttcggcct ggtctccgcg       660
     ctggccgtgc cgctgggcct gacgtccacc gtcgccatcc tggcgctgat gctggggctt       720
     gcggtcggga tcgactacgc actcttcatc acctcccgct tccgcgacga acgggcccag       780
     ggcagcgaac cggaggaggc cgccggccgg gcggtgggca cggccggatc cgccgtcgtc       840
     ttcgccggcg cgaccgtctt catcgccctg gtcgggctgg gggtcgtcgg aatccccgaa       900
     ctcaccaaga tgggcatggg cggcgcgggc gccgtggccc ttgccgtact cgtcgcactg       960
     accctggtcc ccgcgctgtt cggcttcttc ggccgacggg tactgtcccg cgccgtccgc      1020
     aaggaaccct cgtatcgccg atcgggaagc gagcggccgg gaagcgagcg cccgcacccc      1080
     gtgcccaccg cggccggccg gcccgggctc ggcacccgct gggcacggtt cgtgctgcgc      1140
     cgaccggcgg ccgtgctgct gatcgccgga ctcggtctcg gcgccgtcgc cctaccggcg      1200
     ctgagcctcg aactcgggct gcccggagac gagtccaagt cggtggagac cacccagcgc      1260
     cgtgcctacg acctgctgtc agaaggcttc ggccccggct tcaacggccc gttgaccttg      1320
     gtcgtggaca tgccagcgtc ttcggggtcc ggggacaccc gggccaccac ggacctggtc      1380
     gccaagaccg tacggggagt ggacggggtc gcgtcggtcg gtgatccggt tctcagccgg      1440
     ggcaaggaca cggccgtcct caccgccgtc ccgcagaccg cgccgaacag cggcgagacc      1500
     aaggacctgg tgcacgcgat ccggggcgcg gtctccggcg tcgaggccga cacgggcgcc      1560
     gacatcctgg tgaccggcac caccgcgatg aacatcgaca tttccgaagc catgtccgac      1620
     gccctcgtcc cctatctgac cgtggtcatc ggcctggcgg tgctcctgct gatggtggtc      1680
     ttccgctcgg tcctggtccc ggtcaaggcc gcgctcggct tcctgctgtc ggtgggtgcc      1740
     gccttcggtg tcctcgtcgc cgtcttccag tggggctggg cggcagacct gatcggcatc      1800
     gagcagaccg gaccggtcat gtcgctgatg ccgattctca tcatcggaat cgtgttcggc      1860
     ctcgccatgg attacgaggt cttcctcctc acccggatgc gggaggccta cgtccatggc      1920
     gcgtcccccg gcgaggcaat cgtcaacggt ttccggcaca gcggacgtgt ggtggccgcg      1980
     gcggcgatca ttatgatcag cgtgttcgcc ggattcatcg ggatgagcag cccgaccatc      2040
     cagacgatgg gcgtcggcct ggccgccgcc gtcgccttcg acgccttcgt ggtccggatg      2100
     gcgatcgcac ccgcggtcct ggcactgctc ggccaccggg cctggtggct gccccgtatc      2160
     ctgaaccgcg tgctgccgaa tgtggatatc gagggtgaga aactgagcag gcatgtcccg      2220
     gcctccgcag ccgagttgga cgcagcggtg ccgcggctcc ccgtcggccg gcaccggcac      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page