(data stored in ACNUC7421 zone)

EMBL: CP002047.PE617

CP002047.PE617       Location/Qualifiers
FT   CDS_pept        complement(786302..786484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03738"
FT                   /db_xref="UniProtKB/TrEMBL:D7C284"
FT                   /protein_id="ADI03738.1"
FT                   /translation="MAPGIRLRLVVCSMTAKTYSAPSGAVPGAKVGISRDGITYRDAGN
FT                   LTGRGRVRRCHACGV"
     gtggcgccgg gcatccggct gcgcctggtg gtgtgctcga tgacagcgaa gacgtacagc        60
     gcgccgtccg gcgcggtgcc gggcgcgaag gtcggcatca gcagggacgg catcacctac       120
     cgggacgccg ggaacctcac cggccggggc cgcgtgcgtc ggtgtcacgc ctgcggcgtc       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page