(data stored in ACNUC7421 zone)

EMBL: CP002047.PE618

CP002047.PE618       Location/Qualifiers
FT   CDS_pept        complement(786606..792845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00618"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03739"
FT                   /db_xref="GOA:D7C285"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C285"
FT                   /protein_id="ADI03739.1"
FT                   /translation="MSPAQRGPWSLYQLHGPDGTHNVPVVTRIPGVVDREALTAALTDL
FT                   TVRHEALRTLYAEREGVPVQIVVPADRARPRPRFTDTTAEQAEDAIARACAHAIDLSTD
FT                   LPLHAELITTGPKDSNSTLVLTIHHIAIDAWSVRPLLRDFDTAYTARTGGGAPQWGSPP
FT                   RYADHVTETANRLQQLGDRQRKYWTDQLADLPEELRLPVDRPRGQAPGPRPDTVDFTVG
FT                   AEPARAVRASALSRGISMSTVAQAAVAALLHRVGAGDDIPLGIPVSGRPHGESRDLVGR
FT                   FANSLVLRIGLSGDTGFDELLTQVHATLLTAHEHRDLPFEELVEATGKAVSRDPAHHPL
FT                   CQVMVGSLAAAAAPEAPPIDQRADAYDLRFDLAEQGPDGRLHGRIAYRPDLFDPHTAES
FT                   LAQRLVRLLEQVAADPEQPVGRLDVLVADERALVVDGWNDTAHEVPSKTLPELFRAQVA
FT                   RTPDATALVFRDERLTYADLDARVERLARVLAGKGAGPGETVAVALPRSVELVATLLAV
FT                   HRTGAAYLPLDTQYPAERTAFMLDDARPVLVLDGAAPDGPPGELPKAYAPNLPAYVIYT
FT                   SGSTGRPKGVVVPHAGIVNRLLWMRDEYGLSAADRVLQKTSASFDVSVWELFLPLITGA
FT                   TLVVAEPDGHRDPAYLSELIESERITTVHFVPSMLEVFLDALAAEPSAAGCATVRRVIC
FT                   SGEALPAPLAGRFHRVLPTAELHNLYGPTEASVDVTAAQVIPGVEPVPIGRPVWNTRVY
FT                   VLDTALQPVPPGAVGELYLAGVQLAHGYLSRPGLTAGRFVADPYGDVPGARMYRTGDLG
FT                   RRTRDGLLEFLGRADDQVKVHGFRIEPGEIEAVLHAHESVARAVVVAHEQRLLAYVVPA
FT                   PGRVPGETELRDLAQSALPEYMVPSAVIALDALPLTPNGKLDRKALRTSPAHTPGPDGS
FT                   AALGEPERTLGALFAEVLGMTRVGPDDSFFDLGGHSLLAIRLINRIRVRFGVRLKVRTL
FT                   FEAPTVAQLAPRLAEESADRTPPGVVAVVPRPEVLPLSPVQRGLWFLHQLHGPDATHNV
FT                   PVVTRIQGAVDRDALTAALADLTVRHEALRTLYAEREGVTVQIVVPADRARPRPRFTDT
FT                   TAEQAEDAIARACAHAIDLSTDLPLHAELITTGPQDSTLVLTIHHIAIDAWSMRPLTTD
FT                   LARAYAARTRGEAPDWEPLPVQYADYALWYEDTIGDAGDPAGVQSHQLDYWRTALAGLP
FT                   EELTLPADRPRPARASRRGGQVELPIDQALDQRLRQLARTHGVTPYMVAQAALAALFTQ
FT                   LGAGTDIPLGAVVAARPDHTLHDLVGYFLNTLVLRTDTSGDPSFSDLLARVRVTDLAAF
FT                   EHQQLPFDRLVEELQPTRSPSRNPLFQTALVWTDATSAALELPGLRCEPGPVPLDVVKF
FT                   DLEFEFSEHRGSGGSGGSGGSGGSGGSGLRLSVGYATDLYAPATALSLGRRLIQLLEQA
FT                   TAAPDARLSTFQVLLPDERKRILEEWGRGAEVESATIPDLFEEQVRQRPDAIAVEDGDG
FT                   GVTYAELSASVNRLARYLIERGVGPEVPVAVSAERGPGLLVAMLAVLTAGGAYLPIDPA
FT                   YPPARMAFMLADTAATMALVDDPARLGDADIETTVLGGLGLAGFPATEVSDDDRLAPLR
FT                   IASTAYVIYTSGSTGMPKGVAVPHTGITRLISTHTSALGVGPQSVVLQLASIGFDASVW
FT                   EIGMALLTGARLRFIRPEALAEAEHGSTPAHGATHVWISPTLLSALPSAAVPAGTTIVT
FT                   GSEAVPQMVADLWSVDNPLFNLYGPTEVTVGSTGAFLAPGRSVTIGGPIAGTQAYVLDD
FT                   ALRPVPPGVDGELYLAGPGVTRGYVGRAGLTATRFVACPFGAAGERMYRTGDMVRWTAD
FT                   GNLLYLGRTDDQVKLRGFRIEPGEIEATLTALPGVRQAVVTLREDRPGDKRLVAYVISD
FT                   TGAALDTAVLADRLAERLPTYMVPSAFVQLAALPLTINAKLDRAALPAPGHTAASTSQL
FT                   PRNDREEALCKLFADILGVPDVSRDDSFFELGGHSLLAMLLVNRVRAQFGIGLDLQTVF
FT                   EAPTVAELTPHLDNGRRARPALRPRNRP"
     ttgtccccgg cgcagcgtgg tccgtggtcc ctgtatcagc tgcacggccc cgacgggacg        60
     cacaatgtcc cggtggtgac caggatcccg ggtgtggtgg accgggaggc gctcaccgcg       120
     gcgctgacgg acctcacggt gcggcacgag gccctgcgta cgctctatgc cgaacgcgag       180
     ggggtgccgg ttcagatcgt cgttcccgcc gaccgggccc ggccgcggcc gcggttcacc       240
     gacaccacgg ccgagcaggc ggaggatgcc atcgcccgag cctgcgccca cgccatcgac       300
     ctgtccaccg accttcccct gcacgctgaa ctcatcacca ccggcccaaa ggactccaac       360
     tccaccctgg ttctgaccat ccaccacatc gccatcgacg cctggtccgt acgcccgcta       420
     ctcagggatt tcgacactgc ctacacggcg cgcacgggtg gcggggcgcc acagtggggc       480
     tctccgcccc gttacgccga tcatgtgacc gagacggcca accggctcca gcagctgggg       540
     gatcggcaac gcaagtactg gacagatcag ttggccgacc tgcccgagga actgaggctg       600
     cccgtcgacc ggccccgggg acaggcgccc ggtccccggc ccgacaccgt ggacttcacg       660
     gtcggcgcgg aaccggcgcg ggcggtgcgc gcatcggccc tcagccgagg catcagcatg       720
     tcgacagtgg cgcaggcagc cgtcgcagcc ctgctgcacc gcgtcggcgc gggcgacgac       780
     atcccgctcg gcataccggt ctccggccga ccccacggag agtcacggga cctggtcggc       840
     cgcttcgcga actccctggt actgcgcatc ggcctctccg gggacaccgg tttcgacgaa       900
     cttctcaccc aggtccatgc caccctcctg acggcccacg agcaccggga cctgccgttc       960
     gaggaactgg tcgaggcgac cggcaaagcc gtcagccgtg atccagcaca tcatccgctc      1020
     tgccaggtga tggtgggctc actcgcggca gccgccgccc ccgaggcacc cccgatcgat      1080
     cagcgggcgg acgcgtacga cctccggttc gacctcgccg aacaggggcc cgacggccgc      1140
     cttcacggcc ggatcgccta ccgtcccgat ctcttcgacc cgcacacggc cgaatcgctc      1200
     gcacagcgac tggtccgcct gctggagcag gtggcggcgg acccggaaca gccggtgggc      1260
     cgactggacg tgctggtcgc ggacgagcgc gcgctggtcg tggacgggtg gaacgacacc      1320
     gcccacgagg tgccgtccaa gaccctgccg gagctgttcc gggcgcaggt ggcgcggaca      1380
     cccgacgcga ctgcgctggt cttccgggac gagcggctga cgtatgcgga cctggacgca      1440
     cgggtggagc ggctggcacg ggtgctcgcc gggaaaggcg cggggccggg ggagacggtg      1500
     gcggtcgcgc tgccgcgctc ggtggagctg gtggcgacgc tgctcgcggt gcaccgtaca      1560
     ggggcggcct atctgccgct ggacacccag tacccggccg agcggaccgc cttcatgctg      1620
     gacgacgccc gtccggtcct cgtcctggac ggggcggcgc cggatggccc gcccggtgag      1680
     ttgccgaagg cgtacgctcc gaacctgccg gcctatgtga tctacacatc gggctccacc      1740
     ggccgcccca agggtgtggt cgtaccgcac gcgggcatcg tcaaccgact gctgtggatg      1800
     cgggacgagt acgggctgag cgccgccgac cgggtgctcc agaagacgtc cgcgagcttc      1860
     gacgtgtcgg tgtgggagct cttcctgccg ctgatcaccg gggccacgct ggtcgtggcc      1920
     gagcccgacg gccaccgcga cccggcctat ctctccgagc tcatcgagtc cgagcggatc      1980
     accacggtcc acttcgtgcc gtcgatgctg gaggtgttcc tggacgcgct cgcggcagag      2040
     ccgtcagcgg ccgggtgcgc cacggtgcgg cgcgtcatct gcagcggcga ggccctgccc      2100
     gcgccgctcg ccggacgctt ccaccgggtc ctgccgaccg ccgagctgca caacctctac      2160
     ggcccgaccg aggcatcggt ggatgtgacg gctgcccagg tcatccccgg cgtggaaccg      2220
     gtccccatcg gccgcccggt ctggaacacc cgggtctacg tcctggacac ggccctgcag      2280
     ccggtgcctc cgggtgccgt gggggagctc tacctcgcgg gcgtacagct ggcccatggc      2340
     tatctgtccc gccctggcct gaccgcgggg cgtttcgtgg ccgacccgta cggcgatgtc      2400
     cccggcgccc gcatgtaccg caccggtgac ctgggccgac ggacccgcga cggactgctg      2460
     gagttcctgg gccgggcgga cgaccaggtc aaggtgcatg gcttccggat cgagcccggg      2520
     gagatcgagg cggtgctgca cgcgcacgag tcggtggccc gcgccgtcgt ggtggcccat      2580
     gagcagcggc tgctggcgta tgtggtgccc gcgccgggcc gggtgccggg cgagaccgag      2640
     ctccgcgatc tggcccagtc ggcgcttccc gagtacatgg tcccgtccgc cgtcatcgcc      2700
     ctcgacgccc tgccgctcac gccgaacggc aagctggacc gcaaggccct tcggacatcc      2760
     ccggctcaca ccccgggccc cgatgggtca gcggccctgg gtgagcccga acggacgctg      2820
     ggcgcgctgt tcgccgaggt gctgggcatg acccgagtcg gccccgacga cagcttcttc      2880
     gacctgggcg gtcattcttt gctcgccatc cgcctgatca accgcatccg cgtccggttc      2940
     ggcgtccggc tgaaggtgcg caccctgttc gaagcgccga ccgtcgccca gctggctccg      3000
     cgcctcgccg aggagtcggc cgaccggaca ccaccggggg tggtggcggt cgtgccgcgc      3060
     cccgaggtgc tgccgttgtc ccccgtccag cgtggcctgt ggttcctgca ccagttgcac      3120
     ggccccgacg cgacgcacaa tgtcccggtg gtcacccgga tccagggggc ggtggaccgg      3180
     gacgcactga cagcggcact ggccgacctc acggtgcggc acgaggccct gcgtacgctc      3240
     tatgccgaac gcgagggggt gaccgttcag atcgtcgttc ccgccgaccg ggcccggccg      3300
     cggccgcggt tcaccgacac cacggccgag caggcggagg atgccatcgc ccgagcctgc      3360
     gcccacgcca tcgacctgtc caccgacctt cccctgcacg ctgaactcat caccaccggc      3420
     ccacaggact ccaccctcgt cctgaccatc caccacatcg ccatcgacgc ctggtccatg      3480
     aggccgctga ccaccgatct ggcccgtgct tacgcagccc gcactcgggg tgaggctccc      3540
     gactgggagc cgctgcccgt ccagtacgcg gactacgcgc tctggtacga ggacacgatc      3600
     ggggacgccg gtgatccggc cggtgtgcag agccaccagc tcgactactg gcgtacggcc      3660
     ctggccggcc tgcccgagga gctgacgctg cccgccgacc gaccccggcc ggcccgcgct      3720
     tcccgccgcg gcggccaggt cgaactgccg atcgaccagg cactggacca gcggctgcga      3780
     caactggccc ggacccacgg ggtcaccccc tacatggtgg cccaggccgc cctggccgcc      3840
     ctcttcaccc aactgggcgc cggcaccgac attccgctgg gcgccgtcgt cgcggcacgc      3900
     cccgaccaca ccctgcatga tctcgtcggc tatttcctca acaccctggt cctgcgcacc      3960
     gacaccagcg gtgatccctc cttctccgac ctgctcgccc gggtccgcgt gaccgatctg      4020
     gccgccttcg aacaccagca gcttcccttc gaccgcctcg tggaagaact ccagccgact      4080
     cgttccccgt cacgcaatcc cctcttccag acggcacttg tctggaccga cgccaccagc      4140
     gccgccctcg aactgcccgg ccttcgctgc gagcccggcc cggtgcccct ggacgtcgtg      4200
     aagttcgacc tcgaattcga gttcagcgag caccgcggct ccgggggctc cgggggctcc      4260
     gggggttccg gcggctccgg gggctccggg ctcaggctga gcgtcggata cgcgacggac      4320
     ctctacgccc ccgcgaccgc gctcagcctg ggccggcggc tgatccagct gctggagcag      4380
     gcaacggccg cccccgatgc ccggctcagc accttccagg tgctcctccc cgacgagagg      4440
     aagcggatcc tcgaagagtg gggccgtggc gccgaggtcg agtcggcgac catccccgac      4500
     ctgttcgagg agcaggtgcg gcagcgaccg gacgccatcg ccgtcgagga cggcgacggg      4560
     ggagtcacgt acgccgagtt gagcgccagc gtcaaccggc tggcacgcta tctgatcgag      4620
     cgcggagtgg gccccgaggt ccccgtcgcc gtgtcggcgg agcgcggccc cggcctcctg      4680
     gtggccatgc tggcggtgct caccgcgggc ggggcgtacc tgccgatcga cccggcgtat      4740
     cccccggcgc gcatggcctt catgctggcg gacaccgcgg ccacgatggc gctggtggac      4800
     gaccccgcgc ggctcggcga cgcggacatc gaaaccaccg tgctgggcgg cctcggcctg      4860
     gcgggcttcc ccgccaccga ggtgagcgac gacgaccgtc tcgctccgct gcgtatcgcc      4920
     tccacggcgt acgtgatcta cacctccggt tccacgggga tgcccaaggg cgtcgcggtc      4980
     ccccacaccg ggatcacccg gctgatcagc acccacacat ccgccttggg agtcggcccg      5040
     cagagcgtgg tgctgcagtt ggcctcgatc ggcttcgacg cgtccgtgtg ggagatcggc      5100
     atggccctgc tcaccggcgc gaggctccgg ttcatccggc ccgaggcact cgccgaggcc      5160
     gagcatggca gtacgcccgc ccatggcgcg acgcacgtgt ggatctcgcc gacgctgctg      5220
     tccgcgctgc cctcggccgc cgtgccggcc ggaacgacga tcgtcaccgg gtccgaggcg      5280
     gtcccgcaga tggtggctga cctctggtcc gtcgacaacc cgttgttcaa tctctacggg      5340
     ccgaccgagg tcaccgtggg atccaccggc gcattcctgg ccccgggccg ctccgtcacc      5400
     atcggcggac ccatcgccgg cacccaggca tacgtcctgg acgacgccct gcggccggtg      5460
     ccgcccggag tggacggcga gctgtatctc gcgggcccgg gcgtgacccg gggatacgtc      5520
     ggacgcgcgg gactcacggc cacccgcttc gtcgcgtgcc cgttcggcgc ggccggcgaa      5580
     cggatgtacc ggaccggcga catggtccgc tggacggccg acggcaacct gctctacctg      5640
     ggccgtaccg acgaccaggt caagctccgt ggcttccgga tcgagccggg agagatcgaa      5700
     gccaccctga cggccctgcc cggagtacgg caggccgtgg tgacactgcg cgaggaccgg      5760
     cccggcgaca aacgactcgt cgcctacgtg atatcggaca ccggcgccgc actggacacg      5820
     gccgtgctcg ccgaccggct cgccgagcgc ctgcccacgt acatggtgcc gtcggccttc      5880
     gtgcagctgg cggcactgcc tctgacaatc aacgccaagc tggaccgcgc cgcgctgccc      5940
     gcccccggcc acacggccgc ctcgacctcg caactccccc gcaacgaccg ggaagaagcc      6000
     ctgtgtaagc ttttcgccga catcctgggg gtacccgatg tcagccggga cgacagtttc      6060
     ttcgagttgg gcgggcactc actgctcgcc atgctcctgg tcaaccgcgt ccgcgcacag      6120
     tttgggatcg gccttgacct acagaccgtc ttcgaggctc ccacagtcgc cgaactgacg      6180
     cctcacctgg acaacggccg acgcgctcgc ccggcattgc gccctaggaa cagaccctga      6240
//

If you have problems or comments...

PBIL Back to PBIL home page