(data stored in ACNUC7421 zone)

EMBL: CP002047.PE622

CP002047.PE622       Location/Qualifiers
FT   CDS_pept        complement(796294..796560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00622"
FT                   /product="MbtH domain protein"
FT                   /note="COG3251 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03743"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:D7C289"
FT                   /protein_id="ADI03743.1"
FT                   /translation="MTAYTSDREEFAMTNPFDDENGHFRVLVNAEGQHSLWPTFAEVPD
FT                   GWEIRLGDSSRKDCLAYIEKHWTDMRPTSLVAAMAADSQGEAE"
     atgacggcgt atacatctga cagggaggag tttgccatga caaatccatt tgatgacgag        60
     aacgggcatt ttcgggtcct ggttaatgcc gaggggcagc actcgctctg gccgactttc       120
     gccgaggtcc cggatggctg ggagattcga ctgggtgatt cgagccggaa ggactgcctt       180
     gcatacatag agaagcactg gaccgatatg cggcccacca gcctggtggc ggccatggcc       240
     gccgactcgc agggggaggc cgagtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page