(data stored in ACNUC7421 zone)

EMBL: CP002047.PE624

CP002047.PE624       Location/Qualifiers
FT   CDS_pept        797881..801825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00624"
FT                   /product="nonribosomal peptide synthetase DhbF"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03745"
FT                   /db_xref="GOA:D7C291"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C291"
FT                   /protein_id="ADI03745.1"
FT                   /translation="MGVRVADLIPLSFAQQRLWLIDRLEGPSAVYNVPLALRFSGAVNH
FT                   GALEAALRDVVVRHESLRTVFTERADKEEMAHQDILGPEALSVPFEVGETHEGGLAEEL
FT                   EEFGARPFDLAREIPVRARLLLLAPEESVLALVIHHTACDGWSIGPLFRDLGTAYRARC
FT                   RPDGGAPQWAPLPVQYADYALWQREMLGDEDDPDSEVSRQSAFWSAELTGLPEQLPLPA
FT                   DRARPAVSGFRGEAVPIEVGAEAHRVLTRLARDARASSFMVVQVALALLLTRLGAGTDI
FT                   PIGTVTAGRDEVALEELVGFFANTLVLRTDTSGNPTFRELLERVRSRTLKAYAHGELPF
FT                   ERVVELVRPGRSLARHPLFQVMLVFQPEGDAVPDLPGLRVGLEEVDTPSAKFDLTLSLR
FT                   ERFGRDGEPLGLSGELRYRTDLFDHGTSERMAARLVRILAAAARNPELPVGSIDILDAA
FT                   ERHRVLTEWNDTDLAAPTPSLPALFSAQAARTPAAPAVSDKGLVLTYAELDARANRLAH
FT                   LLAARGIGPEKLVAVALPRSAQAVIALLAVLKAGGAYLPLDPGYPVERLGAMLRDARPE
FT                   LVLTTGQADPTAESAIPRLCLDSSPVQAELESRPATDPAVRTHPGHPVYVIYTSGSSGR
FT                   PKGVVVTHGALADYLAWARRAYPATAGTVLLHTSLSFDLTVTALWTPLTVGGCLFTASI
FT                   AEIAEIAEIAEMRGNDSGPAQSAGVVFTFVKATPSHLPLLAEASDICSPTGQLLLAGEA
FT                   LTTEALRTWRRRHPDMTVHNVYGPTETTVSCADFPVEPGAELPPGTVPIGRPLAGTRIY
FT                   VLDSALAPVPPGVVGELYVAGSGLARGYLGRPGLSAERFVACPFGAPGERMYRTGDLAR
FT                   WRPTGVLDFMGRADQQVKVRGFRIEPGEIETVLAADPVVGQVSVVAREDRRGDQRLVAY
FT                   VVPVEGGTPESMDGSAVRERARRLLPEYMVPAAVVPLPALPLTPNGKLDRAALPAPPAG
FT                   VGKSCRGPGTPVEEVLCELFAEALGAEGIGADEGFFELGGHSLLAARLVGRIAARLGVE
FT                   VRLRDLFEAPTVAALARRLSRVGERDGTAFDVLLRLTAGGSGTPLFCVHPGGGISWCYT
FT                   GLIRHLPPDLPVYGLQSRALSPDTTCPATIEEMARDYREQIVSVQPVGPYRLLGWSFGG
FT                   LVAHAVAVQLQEAGEQVRFLGMLDSYPEFHDDGDRLPQWGDDGAVELLNEAIGGLDGLA
FT                   ADEMPRVLAALRHHRALWRGYVPRRYRGDLLFFTAALDRPEGRDAVREWNPFIDGTIEE
FT                   ISVECTHPAMLSPGPSARIGRALATALSPP"
     gtgggggtcc gggtggccga cctgattccg ctgtccttcg cccagcagcg cctgtggctc        60
     atcgaccggc tggaagggcc cagcgcggtc tacaacgtcc ccctggcgct gcgattctcc       120
     ggggccgtga accatggcgc cctggaggcc gccctgcggg atgtggtggt ccgccacgag       180
     agtctgcgca cggtgttcac cgagagggcc gacaaggagg agatggcgca ccaggacatc       240
     ctcggcccgg aggcgctgag cgtgccgttc gaggtgggtg agacacatga gggcggactc       300
     gcggaggagc tcgaggagtt cggcgcgcgc ccgttcgacc tcgcgcggga gatacctgtc       360
     cgcgctcggc tgttgctgct ggcgccggag gaatcggtac tggcgctggt gattcaccac       420
     accgcctgcg acggctggtc catcggcccg ctcttccgtg acctcgggac cgcgtaccgg       480
     gcgcggtgcc ggccggatgg cggcgcgccg cagtgggccc cgctgccggt ccagtacgcg       540
     gactacgccc tctggcagcg ggagatgctc ggtgacgagg acgacccgga cagcgaggtg       600
     tcccgccagt cggccttctg gtccgccgaa ctcaccggcc tgcccgagca gctgccgctg       660
     cccgccgacc gggcccgtcc tgcggtgagc ggcttccgtg gtgaggccgt accgatcgag       720
     gtcggcgccg aggcccaccg tgtactgacc cggttggcac gggacgcgcg ggccagctcc       780
     ttcatggtgg tccaggtcgc gctggcgctg ctgctgacca ggctcggggc cggcaccgac       840
     atcccgatcg gcaccgtgac ggcgggccgc gacgaggtgg cgttggagga actggtcggc       900
     ttcttcgcca acactctggt cctgcgcacc gacacctccg gcaaccccac cttccgggag       960
     ttgctcgagc gggtgcggag caggaccctg aaggcgtacg cacacggcga gcttccgttc      1020
     gagcgagtgg tggaactcgt cagacccggg cggtccctgg ccaggcatcc gctcttccag      1080
     gtgatgctgg tcttccagcc cgagggggat gccgtccccg atctgccggg gttgcgggtc      1140
     ggcctcgaag aggtggacac gccaagcgcc aagttcgatc tgaccctcag tctgcgggag      1200
     cgattcggcc gcgacggcga accgctcggc ctttccggcg aactccgtta tcgcaccgac      1260
     ctgttcgacc acgggacatc cgagcgtatg gccgcccgtc tggtacggat cctggccgcc      1320
     gccgcgcgga acccggagct tcccgtcgga agcatcgata tcctcgacgc cgccgagcgg      1380
     caccgtgtgc tgaccgaatg gaacgacacc gacctggccg cacccacccc gagcctgccc      1440
     gcgctcttct cggcccaggc cgcccggacc ccggccgcac cggccgtgtc cgacaaaggc      1500
     ctggtgctca cgtacgcgga gctggacgcg cgggccaacc ggctggcaca cctgctggcc      1560
     gcacgcggaa tcggcccgga gaagctggtc gcggtcgccc tgccccgttc ggcgcaggcc      1620
     gtcatcgcgc tcctggccgt cctcaaggca gggggcgcct accttccgct ggaccccggc      1680
     tatccggtgg aacggctcgg cgccatgctc cgtgacgccc ggccggagct ggtcctcacc      1740
     acggggcagg ccgacccgac ggccgagtcg gccatccccc ggctgtgcct cgacagctcc      1800
     ccggtccagg ccgagctgga gagccggccc gccaccgatc cggccgtgcg gacacatccc      1860
     ggtcatccgg tctatgtcat ttacacctca ggatcgagcg gccgtcccaa gggtgtcgtc      1920
     gtcacccacg gagctctggc cgactacctg gcctgggcac gccgggccta tccggcgacc      1980
     gccggtacgg ttctgctcca cacatcgctc tcgttcgatc tgacggtcac cgcgctgtgg      2040
     acgccgctga cggtcggcgg ctgtctgttc acggcctcga tcgccgagat cgccgagatc      2100
     gccgagatcg ccgagatgcg cggaaacgat tccggaccgg cacagtcggc cggtgtggtc      2160
     ttcaccttcg tcaaggccac accgagtcat ctgccgctgc tggccgaggc atccgacatc      2220
     tgctcgccca ccggtcagct gctgctcgcc ggcgaagccc tcaccaccga ggcgcttcgc      2280
     acctggcgcc gccggcaccc ggacatgacc gtgcacaacg tgtacggacc gacggagacc      2340
     acggtcagct gcgccgactt ccccgtggag cccggtgccg agctgccgcc cggaacggtg      2400
     cccatcggcc gtcccttggc cggcacccgg atctacgtgc tggattccgc gctggctccg      2460
     gtgccgcctg gtgtcgtggg cgaactgtac gtcgcgggct cgggcctggc ccggggatat      2520
     ctgggccggc cgggcctgtc ggcggagcgg ttcgtcgcat gccctttcgg cgccccgggc      2580
     gagcggatgt accgtaccgg cgatctcgca cggtggcggc cgaccggggt gctggacttc      2640
     atggggcggg ccgaccagca ggtcaaggtc cgtggcttcc gcatcgaacc cggcgagatc      2700
     gagaccgtac tggctgccga cccggtcgtg ggccaggtct cggtggtggc tcgggaggac      2760
     aggcggggag accagcggct ggtggcgtac gtggtgcccg tcgagggcgg gacccccgag      2820
     agcatggacg gctcggccgt gcgcgagcgg gcgcggcggc tgctgccgga gtacatggtg      2880
     cccgccgcgg tggtgccgct tccggcgctg ccgctgactc cgaacggcaa gctcgaccgt      2940
     gctgccctgc ccgcgccacc ggccggcgtc gggaagtcgt gccggggacc gggcacgccg      3000
     gtcgaagagg tcttgtgcga gctgttcgcg gaagctctcg gcgccgaggg gatcggcgcc      3060
     gacgaggggt tcttcgaact gggcggccac tctctgctcg ccgcccggct ggtcggccgg      3120
     atcgcggccc ggctgggcgt ggaggtgcgg ctgcgagacc tgttcgaggc gcctacggtc      3180
     gccgccctcg ccaggcgtct gagcagggtc ggcgagcgtg acgggacggc cttcgacgtc      3240
     cttctgcggc ttacggcggg cggttcgggc accccgctgt tctgcgtgca tccgggtggt      3300
     ggcatcagct ggtgctacac cgggctgatc cgccatctgc caccggatct gccggtttac      3360
     ggactacagt cccgagcgtt gtcgcccgac acgacgtgcc ccgcgaccat cgaggagatg      3420
     gcacgcgact accgcgagca gatcgtctcg gtgcagcccg taggcccgta ccggctgctc      3480
     ggctggtcct tcggcggcct cgtcgcgcat gccgtcgccg tacagctcca agaggcgggc      3540
     gaacaggtgc ggttcctcgg aatgctggac agctatccgg aattccatga cgacggcgac      3600
     cggcttcccc agtggggaga cgacggcgcg gtggaacttc tcaacgaggc gatcggtgga      3660
     ctcgacgggc tcgcggcgga cgagatgccg cgggtgctgg ccgccctgag acatcaccgt      3720
     gcgctgtggc ggggttacgt accccggcgc taccggggag atctcctctt cttcaccgcc      3780
     gccctggacc ggcccgaggg ccgggacgcg gtcagggagt ggaacccttt catcgatggg      3840
     acgatcgagg agatctccgt cgagtgcact catccggcga tgctgtcccc cggaccgtcg      3900
     gccaggatcg gaagagcgct ggcaaccgcg ctctctcccc cctga                      3945
//

If you have problems or comments...

PBIL Back to PBIL home page