(data stored in ACNUC7421 zone)

EMBL: CP002047.PE625

CP002047.PE625       Location/Qualifiers
FT   CDS_pept        complement(801750..807356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00625"
FT                   /product="amino acid adenylation domain-containing protein"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03746"
FT                   /db_xref="GOA:D7C292"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C292"
FT                   /protein_id="ADI03746.1"
FT                   /translation="MADSAPHDLPLSFGQEQLWFLDRLRPGNSVHSVAAALRIRGDLDI
FT                   EALRRAFGEIVRRHDTLRACFPDRAGVPVWVPADSADLPLSFTDLGGLPEDRREPEAER
FT                   LLSEEADAPFDLASGPLIRLGLVRLSGEDHALAVTAHQIVLDSASMEVLLRELGQVYAA
FT                   FRDGRPPVLPTPLPRYADYAREQRGRSYTASLEYWRKQLDDVPTMLRLPCDRRRPAVRS
FT                   GRGAVQSFELGSELTTRLTGFSDSRGTTVATTVLAAFKTLLAHYCDQRDITVGTILPNR
FT                   PQGEPDSAVGQFANTVVLRSDLSGEPGFGEVLRRVDAAAREAAVHGDVPFEELIRVLQP
FT                   ERDPSSTPLFQVLFRASEGCEEAPEFAGLAVERIDLPRTSARFDLTLGVRHLGERLICE
FT                   LEYSTDLFEPATIRRMAGHLRQLLEDALAHPDRPVSALRLLLPAEREQILTGWNDTGSQ
FT                   GGVPRCLHTLFEEQVRRTPEALAVVWRDQRLTYRQLDERANQMAHALRSRGVGAETGVG
FT                   ICLERSAATLVALLAVFKAGGTFIPLDPDYPAERLAFMLSDSHASLLISDATTAAALTG
FT                   ADAVPALLIDRDDPEIRSQPTVPPVTGVLPSNLAGMLYTSGSTGTPKCAMLTHANFANY
FT                   FHSFEERYGLSRSLRAHLQMASFSFDMFMGDTMRALFTGATLVVCPREVSLSPPELLDL
FT                   MLQEGINSAEFVPPLLRVFLDHVEASGQSLEFLDFLMAGGDVWYVRDFERARRLCHPGT
FT                   VMAGTYGLTESAIDNTHFSEGHAGDDPEGALPVGRPLPGSRIYILNSALQPVPPGVAGE
FT                   LYVGGDGVGRGYFGRTALTATRFVPDPFSGVPGARLYRSGDLTRYRPDGTIEIVGRSDH
FT                   QVKVRGFRVELGEVEEALRGHPDVEDALVILHDKVPGDRHLVAYASVAAGRWPTSAETR
FT                   PAWERETRARLRDHLRGRLPGFMIPSAIVLLESMPLNSNGKLNRRGLPSPEKELSAQAG
FT                   GGAEPRTPAEEIIGGIWSAVIGLGGIGVHDNFFSIGGHSLLATQVLARIRTDLGAELPV
FT                   RAIYESPTIAGLAERAEASLRSGTPTTPPITSLPRVAGQRLPLSFAQRRLWFIDQLEPG
FT                   SPAYNIASPLRLRGALDREALRRSLEAMVERHEVLRTVFGSDDGEPWQEIRPAPSWELA
FT                   LTDLGGLGPGERTREAERLVSEEAMRPFDLVRGPLMRTELLRLAADEHILLLTMHHLVT
FT                   DGWSGSVFFEDLAALYAAGGHQERAGLTELPVSYADYAVWQRDWLRDGGLEHQLVYWKD
FT                   RLANAPAAIELPFDRPREAAGSSAGRVVEFRVPADVLDGIRAVSQASSATVFITLLAAF
FT                   HCLMGRLTGQDDIVVAVPTAARGRTELDRLVGFFVNTLALRADLSGNPTFRSLLDQVRR
FT                   VALDGYAHQDVPFEKIVEELNPDRSPWHNPLAQVLFVLQNNAPETAELTGLDVEPVPFD
FT                   VRTSQFDLGMQLWETDSGLQGMLSYRTELFDADTAERIISLWSTLLHSVAAAPDTRLSD
FT                   LPLSATRPLAPPPTGAQLPPPPIPDGQTVISLFDAQVRRTPDRIAVVYGATELTYAELG
FT                   ERVDQMAPVLREAGVGPELTVAVALPRSAHLVIATLAVLKAGGCCLPLDPGAPDERLEL
FT                   LPTDCPPVLTVTDRAHAWFLPADLPTLVIGEPRPATPPDVRTPSPQPAGAACVVRAAGE
FT                   HGEPLGAVLSHQDVLRVITGTGPCPGLGDVFDFTVWEWWGRLLRGSRVTVASRRPAGRA
FT                   ADTSTYPSADRPPGYVLDGAGRRVPPGVVGELYLPGPGPARGYPGRPALTAERFVADPY
FT                   GPPGGRMYRTGARARLRGDGSVDLVGRADQGGESAVASALPILADGPGDSIAG"
     atggccgact cagccccgca cgatctgccg ctgtccttcg gacaggagca gctctggttc        60
     ctcgacagac tgcggccggg caactcggtc cacagcgtcg ctgccgccct gcgcatccgg       120
     ggggacctgg atatcgaggc gctgcgtcgg gccttcggcg agatcgtgcg gcgccacgac       180
     acgctccggg cctgtttccc cgacagggcc ggcgtgccgg tgtgggtacc ggccgatagc       240
     gcggatcttc cgctgtcgtt caccgatctc ggcgggctcc cggaggaccg gcgggaaccc       300
     gaggcggagc ggctgttgag cgaggaggcc gacgctccct tcgatcttgc gtcggggccg       360
     ctgatccggt tggggctggt gcgcctgtcc ggcgaggacc acgcgctggc cgtcaccgcg       420
     caccagatcg tccttgacag cgcatccatg gaggtgctgc tccgcgagct cgggcaggtc       480
     tacgcggcgt tccgggacgg ccggcccccc gtactgccca cgcccctccc gcggtacgcc       540
     gactacgcgc gcgagcagcg cggccggtcg tacaccgcct cgctggaata ctggcggaag       600
     cagctcgatg acgtgcccac gatgctgcgg ctgccgtgcg acagacgccg gccggccgtg       660
     cgcagcggac gcggcgcggt ccaaagcttc gaactcggct cggagttgac gacccggctg       720
     accggcttca gcgatagccg gggaaccacc gtggcaacca cggtcctcgc ggcgttcaag       780
     accctgcttg ctcactactg cgaccagcgg gacattacgg tgggcacgat cctgcccaac       840
     cggccgcagg gcgaaccgga cagcgcggtc gggcagttcg cgaacacggt ggtgctccgc       900
     agcgacctct ccggcgagcc cggtttcggt gaggtcctcc gccgggtgga cgcggcggcg       960
     cgggaggcgg cggtgcacgg cgacgtgcct ttcgaagagc tgatcagagt ccttcagccg      1020
     gaacgtgatc cgagttccac cccactgttc caggtgctgt tccgcgcgtc ggaagggtgc      1080
     gaggaagcac cggagttcgc cgggctcgcg gtggagcgca tcgatctgcc ccgcacctcc      1140
     gccaggttcg atctcaccct gggggtaagg catctggggg agcggctgat ctgcgagctg      1200
     gaatacagca ccgacctgtt cgagcccgcc acgatccggc gcatggccgg acacctgcgg      1260
     cagctgctcg aggacgccct ggcccatccc gaccggcccg tcagcgcact gcgcctgctc      1320
     ctcccagcgg aacgcgagca gatcctgacc ggctggaacg acaccggctc gcagggcggt      1380
     gtgccccggt gcctgcacac cctcttcgag gagcaggtcc gccgcacgcc ggaagccctc      1440
     gcggtggtgt ggcgggatca gcgcctcacc taccgtcaac tggacgagcg cgccaaccag      1500
     atggcgcacg ccctgcgctc ccgaggggtc ggggccgaaa ccggcgtcgg catctgcctg      1560
     gagcgctcgg ccgcgactct ggtcgccctt ctcgcagtgt tcaaggcggg gggtaccttc      1620
     atcccgctgg atccggacta cccggcggag cgcctggcgt tcatgctgtc ggactcccac      1680
     gcctcgctgc tgatctccga cgccaccacg gcagcggccc tgaccggagc cgacgcggta      1740
     cccgccctcc tgatcgacag ggacgacccg gagatacggt cgcagccgac agtcccgccg      1800
     gtgaccggcg tgctcccgtc gaatctcgca ggcatgctct acacctcggg ctcgaccgga      1860
     acccccaaat gcgcgatgct cacgcacgcg aacttcgcca actacttcca ctcgttcgag      1920
     gagcgctacg gcctgagccg gagcctgagg gctcatctgc agatggcgag cttctccttc      1980
     gacatgttca tgggcgacac catgcgcgcg ctgttcaccg gtgccacgct ggtggtgtgc      2040
     ccgcgcgagg tctcgctgtc gccaccggag ctgctcgacc tgatgctcca ggaaggcatc      2100
     aacagcgcgg agttcgtgcc gccgctgctg cgggtgttcc tggaccatgt cgaggcgagc      2160
     gggcagtcgc tggagttcct ggacttcctc atggcgggtg gtgatgtctg gtacgtacgc      2220
     gacttcgagc gcgcgcggcg tctgtgccac ccggggaccg tgatggccgg gacctacggt      2280
     ctcaccgagt ccgccatcga caacacccac ttctccgagg ggcacgccgg cgacgacccc      2340
     gaaggcgcgc tcccggtcgg ccgcccgctg ccgggcagcc ggatctacat cctcaacagc      2400
     gcgctgcagc cggtcccgcc cggagtcgcg ggtgagctct atgtcggggg tgacggtgtc      2460
     gggcgcggct acttcggccg gacggccctg accgcgaccc gtttcgttcc ggacccgttc      2520
     agcggggtcc ccggggcacg gctttaccgc agcggtgacc tgacccggta ccgccccgac      2580
     ggcacgatcg agatcgtcgg ccggtccgac caccaggtga aggtccgtgg cttccgggtc      2640
     gagctggggg aggtcgagga agccctgcgc ggccacccgg atgtcgagga cgccctggtc      2700
     atcctgcatg acaaggtccc tggggaccgg catctggtgg cctatgcgtc ggtcgccgcc      2760
     ggacggtggc cgacttcggc cgaaacacgg cctgcttggg agcgagagac ccgggcccgg      2820
     ctgcgcgatc atctgcgtgg gcggctgccg ggcttcatga tcccttcagc gatcgttctg      2880
     ctggagagca tgccgctcaa ctccaacgga aagctcaacc gccgaggact gccgagcccc      2940
     gaaaaggagc tgtccgccca ggccggcggc ggcgcggagc cgcgcacccc ggccgaggag      3000
     atcatcgggg gcatctggag cgctgtcatc gggctcggtg gcatcggcgt gcacgacaac      3060
     ttcttctcca tcggcgggca ttcactcctg gccacccagg tgctcgcccg gatccgcacc      3120
     gatctgggcg ccgagctccc ggttcgcgcg atctacgaga gcccgacgat cgcgggactc      3180
     gccgaacggg ccgaggcgtc gctgcggtcc ggcacaccga cgacgccgcc gatcacatcg      3240
     ctgccccgcg tcgccggaca gcggcttccg ctgtcgttcg cccagcggcg cctgtggttc      3300
     atcgaccagt tggagccggg cagcccggca tacaacatcg cctctccgct gcggctgcgc      3360
     ggcgcgctcg atcgggaggc actgcggcgg agcctggagg cgatggtcga acgccacgag      3420
     gtgctgcgta cggtcttcgg ttccgatgac ggcgagccgt ggcaggagat ccggcccgcg      3480
     ccgtcctggg aactggctct caccgatctc ggcgggctgg ggccgggaga gcggacgcgc      3540
     gaagccgagc ggctggtcag cgaggaggcc atgcgcccct tcgacctggt ccggggaccg      3600
     ctcatgcgga cggagctgct gcgtctggcc gccgacgagc acatcctgct gctgaccatg      3660
     caccacctcg tcaccgacgg ctggtccggc agcgtcttct tcgaggacct ggccgccctc      3720
     tacgcggccg ggggtcacca ggagcgggcg ggcctgaccg agctgccggt gagctacgcc      3780
     gactacgcgg tgtggcagcg cgactggctg cgggacgggg gtctcgaaca ccaactggtc      3840
     tactggaagg acaggctggc caacgcgccg gcggccatcg agctgccgtt cgatcgacct      3900
     cgcgaggctg ccggcagttc ggcgggacgg gtcgtggaat tccgtgtccc ggccgatgtt      3960
     ctggacggga tccgcgctgt cagtcaggcc tcgagcgcca cggtgttcat caccttgctc      4020
     gcggccttcc actgcttgat gggcaggctc accggtcagg acgacatcgt ggtggccgtg      4080
     ccgaccgctg cccggggccg taccgaactc gaccgtctcg tgggcttctt cgtcaacacc      4140
     ctggcgctgc gcgccgacct ttccgggaat cccaccttcc gatccttgct ggaccaggta      4200
     cggcgagtgg cgctggacgg ctacgcgcac caggacgtgc cgttcgagaa gatcgtcgag      4260
     gagctgaacc cggaccggag tccatggcac aacccgctgg cccaggtgct cttcgtactg      4320
     cagaacaacg ccccggagac cgccgaactg accggacttg acgtggagcc cgtaccgttc      4380
     gacgtccgca cctcacagtt cgacctcggc atgcagctct gggagaccga cagcgggctc      4440
     cagggcatgc tctcgtaccg caccgaactc ttcgacgcgg acaccgctga gcggatcatc      4500
     tccttgtgga gcacgctgct gcacagcgtg gcggcagccc cggacacacg cctgtccgac      4560
     ctgcccctct ccgccacccg cccgctcgct ccaccgccga ccggcgcgca gctcccgcca      4620
     ccgccgatcc ccgacgggca gaccgtcatc tccctctttg acgcccaggt ccggcgcaca      4680
     cccgaccgga tcgcggtggt gtacggcgcc accgagctca cgtacgccga actcggcgag      4740
     cgggtggacc agatggcgcc ggtgctgcgg gaggcggggg tgggaccgga gctgaccgtg      4800
     gcggtggcgc tgccccgctc ggcccatctg gtgatcgcga cgctcgccgt gctcaaagcc      4860
     ggaggctgct gtcttccgct cgaccccggc gcgccggacg agcgtctcga actgctgccg      4920
     accgactgcc cgccggtcct gaccgtcacg gatcgtgccc atgcctggtt cctccccgcc      4980
     gacctgccca cccttgtcat cggcgaacca cgtccggcca ccccgccgga tgtccgcaca      5040
     ccgtctccac agccggccgg cgccgcctgc gtggtccggg ccgcgggcga gcacggcgaa      5100
     cccctggggg ccgtcctctc ccaccaggac gtgctgcgtg tgatcaccgg gaccggtccc      5160
     tgtcccgggc tcggcgacgt cttcgacttc accgtttggg aatggtgggg gcggttgctg      5220
     cgtggcagcc gcgtgaccgt cgcgtcccgc cgtccggccg ggcgggccgc agacacctcc      5280
     acctacccga gcgccgaccg gcccccgggc tacgtactgg acggagccgg gcggcgggtg      5340
     ccgcccggcg tcgtcggcga gctgtacctg cccggtccgg ggcctgcccg tggctacccg      5400
     gggcgaccgg ccctcaccgc cgagcgcttc gtggccgatc cgtacgggcc gcccggcggg      5460
     cggatgtacc gcaccggcgc ccgggcccgg ctgcgcggcg acggctctgt ggacctcgtg      5520
     ggccgggcag atcagggggg agagagcgcg gttgccagcg ctcttccgat cctggccgac      5580
     ggtccggggg acagcatcgc cggatga                                          5607
//

If you have problems or comments...

PBIL Back to PBIL home page