(data stored in ACNUC7421 zone)

EMBL: CP002047.PE626

CP002047.PE626       Location/Qualifiers
FT   CDS_pept        complement(807455..808165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00626"
FT                   /product="hypothetical protein"
FT                   /note="COG2045 Phosphosulfolactate phosphohydrolase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03747"
FT                   /db_xref="GOA:D7C293"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:D7C293"
FT                   /protein_id="ADI03747.1"
FT                   /translation="MIGMDACFLGIAELVEAPSVAVVVDVMRAFTVAAWAFAQGAEKIV
FT                   LAESLDEALALKARHPDWVALKDGPPAPGFDMVNSPGLLRSVDLGGRTVVQKTTAGTVG
FT                   ALAVKEASLVLCAGFVVAEATARLLRTRKGDRVTFVVTGDDGQADEDLACAQYIARRAT
FT                   GAGTDAAEFVRRAAESRAAAELAEGVRQGAHSDDVALCLEVDRFPFAMVATLEGSLMVL
FT                   RPRAMQSLTDDAPI"
     atgatcggaa tggacgcttg tttccttggc atcgctgagc tggtcgaagc cccgtccgtg        60
     gcggtcgtag tcgacgtcat gcgtgctttc acggtggctg cctgggcctt tgcccagggg       120
     gcggagaaga tcgttcttgc tgagtcgctg gacgaagccc tggcgctcaa ggctcgccac       180
     ccggattggg tggcgctcaa agacggtccg cccgcgccgg ggttcgacat ggtcaactcg       240
     ccgggcctgc tgcgctctgt tgaccttggc ggacggaccg ttgtgcagaa gaccacggca       300
     gggaccgtcg gcgccctcgc cgtcaaggag gcgtcgctgg tgctgtgcgc cggcttcgtg       360
     gtggcggagg caacggctcg gctcttgcgg acgcgcaagg gcgacagggt cacgttcgtg       420
     gtcactggcg acgatgggca ggccgatgaa gatctggcgt gtgctcaata catcgcccgg       480
     agggccacgg gggctgggac ggatgctgct gagttcgtcc gccgcgctgc cgagtcgcgc       540
     gccgctgccg agttggcgga gggggtgcgt caaggagccc attctgatga cgtcgcactc       600
     tgtcttgagg tcgaccggtt cccctttgcc atggtggcga ccttggaagg ttcgctcatg       660
     gtcctccgcc cgcgcgccat gcagtcgctg accgacgatg ccccgatctg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page