(data stored in ACNUC7421 zone)

EMBL: CP002047.PE630

CP002047.PE630       Location/Qualifiers
FT   CDS_pept        complement(811721..812473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00630"
FT                   /product="hypothetical protein"
FT                   /note="COG1891 Uncharacterized protein conserved in
FT                   archaea"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03751"
FT                   /db_xref="GOA:D7C297"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D7C297"
FT                   /protein_id="ADI03751.1"
FT                   /translation="MLLISPDSVEEALDCAKAAEHLDIVDVKKPDEGSLGANFPWVIRE
FT                   IRDAVPADKPVSATVGDVPYKPGTVAQAALGAVVSGATYIKVGLYGCTTPEQAIAVMRG
FT                   VVRAVKDYRPDAFVVASGYADASRIGCVNPLALPDIARRSGSDAAMLDTAIKDGTRLFD
FT                   HVPPDVCAEFVRLAHEADLLAALAGSVKVADLGALTRIGTDIVGVRGAVCQGGDRNTGR
FT                   IQPQLVAAFRAEMDRHAREHAAAVAPAS"
     ttgctactca tctccccgga cagcgtcgag gaggccctcg actgtgcgaa ggcggcggag        60
     cacctcgaca tcgtcgatgt caagaagcct gacgagggct cgctgggcgc gaacttcccg       120
     tgggtcatca gggagatccg cgatgcggtc ccggcggaca agcccgtgtc cgccaccgtg       180
     ggagacgtac cgtacaagcc cggcacggtg gcccaggcgg cgctcggtgc agttgtctcc       240
     ggggccacgt atatcaaggt cggcctctac ggatgcacga cgcccgaaca ggccatcgct       300
     gtcatgcgag gggtcgtccg ggcggtgaag gactatcggc cggacgcgtt cgtcgtcgcc       360
     tcgggctacg ccgacgccag ccggatcggc tgcgtcaacc cgctcgcgct gcccgacatc       420
     gcccgccgct ccggctccga tgcggccatg ctcgacaccg cgatcaagga cgggacacgg       480
     ctgttcgacc acgttccgcc cgacgtctgc gcggagttcg tccggctggc ccacgaggcc       540
     gatctgctcg ccgccctcgc gggcagcgtc aaggtggcag acctcggcgc gctgacccgc       600
     atcggcacgg acatcgtggg ggtgcgcggg gcggtctgcc aggggggcga ccgtaacacc       660
     ggaaggattc agccgcagct ggtggccgcc ttccgggcgg agatggaccg gcatgcccgg       720
     gaacacgcgg ctgccgtcgc ccccgcgagc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page