(data stored in ACNUC7421 zone)

EMBL: CP002047.PE631

CP002047.PE631       Location/Qualifiers
FT   CDS_pept        complement(812877..814055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03752"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7C298"
FT                   /protein_id="ADI03752.1"
FT                   /translation="MNTEHDWITTPVTADILRGFLDVETTPHGLLPHRLPVRARRQIPD
FT                   NQLAVAEAQPSGVRLVFRTRATTIELDTLPTKRVYRGFPAPADGVYDLLVDGRLAAQAT
FT                   VAGGNVRTITDMVTQSSELSEGPAGTARFTDLPARDKEVEIWLPHTEITELIALRTDAP
FT                   VEPAPDSGRRVWLHHGSSISHGSNATHPTAIWPALAAARGGVELVNMGFGGSALLDPFT
FT                   ARAMRDTVADLISVKVGINVVNSDVMRLRAFAPAVHGFLDTIREGHPTTPLLVVSPILC
FT                   PVQEDTPGPLAPDFDGGTLRFKATGDPAERAAGRLTLNVIRAELARIVERRAADDPNLH
FT                   HLDGRDLYGETDYAEFPLPDEVHPDPAAHRRIAENFGRLAFGDGGPFATKPG"
     atgaacactg agcacgactg gatcaccaca cctgtcaccg cggacatcct gcgcggtttc        60
     ctcgacgtgg aaacgacccc gcatggtctg ctgccgcatc ggctgcccgt acgggctcgt       120
     cggcagattc ctgacaacca actggccgtg gccgaggccc agccctccgg cgtacggctg       180
     gtcttccgca cccgggccac cacgatcgag ctggacacgc tgcccacgaa gcgggtctac       240
     cgaggtttcc cggccccggc ggacggggtg tacgacctgc tggtcgatgg ccgtctcgcg       300
     gcgcaggcca cggtggccgg cggtaacgtg cgcacgatca ccgacatggt cacccagtcc       360
     tccgagctgt cggaggggcc tgccggcacc gcccggttca ccgatctgcc ggcgcgtgac       420
     aaggaggtcg agatctggct tccgcatacg gagatcaccg agctgatcgc cctgcgcacc       480
     gatgctccgg tcgagccggc gccggacagc gggcgcaggg tgtggctgca ccacggcagt       540
     tccatcagcc acggctcgaa cgccacgcat ccgaccgcca tctggccggc cctggccgca       600
     gcccggggcg gagtggaact ggtcaacatg gggttcggcg gcagcgcgct gctggacccg       660
     ttcaccgcac gtgcgatgcg ggacaccgtt gcggacctga tcagcgtcaa ggtcggcatc       720
     aatgtcgtca actccgacgt catgcgcctg cgtgccttcg cccccgcggt ccacggtttc       780
     ctcgacacca tccgcgaggg gcatccgacc acgccgctgc tggtcgtgtc ccccatcctg       840
     tgcccggtcc aggaggacac ccccggcccc ctcgcacccg acttcgacgg cggcaccttg       900
     cggttcaagg ccaccggcga cccagccgaa cgcgctgccg ggcgcctgac actcaacgtc       960
     atccgtgccg aacttgcccg gatcgtcgaa cggcgggcgg ccgacgaccc caacctgcac      1020
     cacctcgacg gccgcgacct ctacggcgag acggactacg ccgaattccc gctgcccgac      1080
     gaggtccacc ccgatcccgc ggcacaccgc cgcattgccg agaacttcgg gcggctggcg      1140
     ttcggtgacg gcggcccctt tgccaccaag cccggctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page