(data stored in ACNUC7421 zone)

EMBL: CP002047.PE633

CP002047.PE633       Location/Qualifiers
FT   CDS_pept        814743..814940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03754"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A0"
FT                   /protein_id="ADI03754.1"
FT                   /translation="MTALGQPLRLGRMARAWPFTGVGSAESSCDSDSDEKLRLLAALSH
FT                   TESVGTAHDGPVDIPHPKTP"
     atgactgcac tgggtcagcc cttgcggctg gggagaatgg ccagggcctg gcccttcacg        60
     ggggtggggt ccgctgagag cagttgcgac agcgacagcg acgagaaact gcggctcctc       120
     gccgcactct cacacaccga gtccgtcggc acagcgcacg acgggccggt ggacatcccg       180
     cacccgaaga caccctga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page