(data stored in ACNUC7421 zone)

EMBL: CP002047.PE634

CP002047.PE634       Location/Qualifiers
FT   CDS_pept        complement(815010..819215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00634"
FT                   /product="secreted glycosyl hydrolase"
FT                   /note="COG3979 Uncharacterized protein contain
FT                   chitin-binding domain type 3"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03755"
FT                   /db_xref="GOA:D7C2A1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A1"
FT                   /protein_id="ADI03755.1"
FT                   /translation="MVLGLPAVGAQAAGGPNAAADAPAKSGSAVGAHAAANVADGDADT
FT                   YWQAGKKSAQWVQTDLGRTERVRQVVLRLPADWQTRKQTLALQGSADGKSFATLKSSAQ
FT                   YVFSPGNGNTVKISFPATLTRYVRADFSKNSVASTGQLGEMQVFTAAASTPNLALGKTF
FT                   TESGHADVYGAANAGDGNRATYWESKNNAFPQWLQVDLGSSVKVNEVTLRLPSGWPSRS
FT                   QTLKIQGSTDNQNFTDLTASKAYTFDSGNDQSATIGFDTTTTRYVRVLITANSGWPAGQ
FT                   LSELEVYGPTTGDTQAPTAPTNLSYTEPATGQIKLTWNAATDDTGVTGYDIYAGGQLRA
FT                   SVAGNVLTYTDTQPADSDITYYVRAKDAAGNVSANSNSVTRKGTSGDTQAPTAPGNLAY
FT                   TQSGNDVKLTWQASTDNVKVTGYDVYAGGELAKSVAGDVTTYTDTPSAAATVTYYVKAK
FT                   DAAGNVSAASNSVTRPGSGSGSDLAQGKPIEASSYTFTYVAANANDGQTSTYWESAGGA
FT                   YPATLTTKLGANADLSQVVVKLNPDAAWSTRTQNIQVLGRDQDATAFTSLVAAKDYTFN
FT                   PSSGNTVTIPVTGAAADIQLKFTANSGAPGAQVAEFQVIGTPAANPDLKVTGITNTPAA
FT                   PVETDAVSLSATVTNSGTKASKATDLNFTLGGTKAATADVPALAAGESKTVTASIGTRD
FT                   AGSYAVGAEVDPSNKVIEQNEANNAFTRSDALVVKPVSSSDLVAAPVSWAPSSPSAGED
FT                   VKFTVAIKNQGTTASASGAHDVTLTIQDSKGATVKTLTGSYNGAIAAGQTTAPVSLGSW
FT                   TAANGKYTVKTVIADDANEVPVKRANNTTTQPLFVGRGANMPYDIYEAEDGTVGGGAKV
FT                   VGPNRTIGDFAGEASGRKAVTLGATGQYVEWTTRAATNTLVTRFSIPDGTNTTLNVYVD
FT                   GQFLKAIDLTSKYAWLYGNETAPGNSPGSGAPRHIYDEANLLLGKTVPAGSKIRLQKDA
FT                   ANTSTYAIDFINTEQATAASNPDPAAYAVPAGFSQQDVQNALDKVRMDTTGKLVGVYLP
FT                   AGDYETSSKFQVYGKAVKVVGAGPWFTRFHAPSSQENTDIGFRADATAKGSTFAGFAYF
FT                   GNYTSRIDGPGKVFDFAGVSDITIDNIWVEHMVCLYWGANTDNMTIQNSRIRDMFADGI
FT                   NMTNGSTDNHVVNNDARATGDDSFALFSAIDAGGADEKNNLYENLTSTLTWRAAGIAVY
FT                   GGYNNTFRNIRVADTLVYSGITISSLDFGYPMNGFGTEPTTIENVSLERTGGHFWGSQV
FT                   FPAIWAFSASKVFQGIRVNDVDIDDSTYGGVMFQTNYVGGQPQFPVKDTIFTDISITNS
FT                   KKSGDAFDAKSGFGIWANELPEPGQGPAVGEATFRNLRMSGNAQDIRNTTSTFRINVE"
     atggtcctag gcctgcccgc cgtcggcgcg caggcggccg gcggtcccaa cgccgccgcg        60
     gacgccccgg ccaagtccgg cagcgccgtc ggtgcccacg cggccgccaa tgtcgccgac       120
     ggcgacgccg acacctactg gcaggccgga aagaagtccg cccagtgggt gcagaccgac       180
     ctcggccgga ccgagcgcgt ccgccaggtc gtgctgcgcc tgcccgccga ctggcagacc       240
     cgtaagcaga cgctggccct ccagggcagt gccgacggca agagctttgc cacgctcaag       300
     tcgtcggcgc agtacgtctt cagccccggc aacggcaaca cggtcaagat ctccttcccc       360
     gcgaccctca cccggtacgt gcgcgccgac ttcagcaaga actcggtcgc ctccaccggc       420
     cagctcggcg agatgcaggt cttcacggcc gccgcatcga cccccaacct cgccctgggc       480
     aagaccttca ccgagagcgg gcacgccgac gtctacgggg cggccaacgc cggcgacggc       540
     aaccgggcca cctactggga gagcaagaac aacgccttcc cccagtggct ccaggtcgac       600
     ctgggatcgt cggtcaaggt gaacgaggtg accctgcggc tgcccagcgg atggccgagc       660
     cgcagtcaga cgctcaagat ccagggctcg acggacaacc agaacttcac cgacctgacg       720
     gcctcgaagg cgtacacctt cgacagcggc aacgaccagt cggcgaccat cggcttcgac       780
     accaccacga cgcgctacgt gcgcgtgctg atcaccgcca actccggctg gcccgccggg       840
     cagttgtccg agctcgaggt atacggaccg accaccggcg acacccaggc acccaccgcg       900
     ccgacgaacc tgagctacac cgagccggcc accggccaga tcaagctgac ctggaacgcg       960
     gccaccgacg acaccggcgt gaccggctac gacatctacg cgggcggaca gctgcgggcg      1020
     agcgtcgccg ggaacgtcct gacgtacacg gacacccagc cggccgacag cgacatcacg      1080
     tactacgtcc gggccaagga cgccgcgggc aacgtctccg ccaacagcaa cagcgtcacc      1140
     cgcaagggaa cgagcggcga cacccaggcc cccaccgcgc ccggcaacct cgcctacaca      1200
     cagtccggca acgacgtgaa gctcacctgg caggcgtcga ccgacaacgt caaggtcacc      1260
     ggctacgacg tctacgcggg cggcgagctc gccaagtccg tggcgggcga cgtcacgacg      1320
     tacaccgaca ccccgtcggc cgcggcgacg gtcacctact acgtgaaggc gaaggacgct      1380
     gccgggaacg tgtcggcggc gagcaacagc gtcacccggc ccggttccgg ttccggctcc      1440
     gacctcgccc agggcaagcc catcgaggca tcctcgtaca ccttcaccta cgtcgccgcc      1500
     aacgccaacg acggccagac cagcacctac tgggagagcg cgggcggcgc ctacccggcc      1560
     accctcacca ccaagctggg cgccaacgcc gacctcagcc aggtcgtcgt caaactcaac      1620
     ccggacgcgg cctggtccac gcgcacccag aacatccagg tgctcggccg cgaccaggat      1680
     gcgacggcct tcacgagcct cgtggcggcg aaggactaca ccttcaaccc gtccagcggc      1740
     aacaccgtga cgatcccggt caccggcgcg gccgcggaca tccagctgaa gttcaccgcc      1800
     aactccggcg ctccgggcgc gcaggtcgcc gagttccagg tgatcggcac cccggccgcc      1860
     aacccggacc tcaaggtcac cggcatcacg aacacgcccg ccgccccggt ggagaccgac      1920
     gccgtcagcc tctcggcgac cgtcaccaac agcggcacca aggcgtcgaa ggccaccgac      1980
     ctgaacttca cgctcggcgg cacgaaggcc gccacggcgg acgtcccggc cctcgcggcc      2040
     ggcgagtcga agacggtcac cgcgagcatc ggcacgcggg acgcgggcag ttacgcggtc      2100
     ggcgccgagg tggatccgtc gaacaaggtc atcgagcaga acgaggcgaa caacgccttc      2160
     acccgctccg atgcccttgt cgtcaagccg gtctccagct ccgacctggt cgccgcaccg      2220
     gtctcgtggg ccccgtccag cccgtcggcc ggtgaagacg tcaaattcac cgtcgcgatc      2280
     aagaaccagg gcacgacggc ctcggcctcg ggtgcccacg acgtgacgct gacgatccag      2340
     gactccaagg gcgccaccgt caagaccctg accggctcct acaacggcgc catcgcggcc      2400
     ggtcagacga ccgcacccgt cagcctcggt tcgtggacgg ccgccaacgg caagtacacc      2460
     gtcaagaccg tcatcgccga cgacgccaac gaagtgccgg tcaaacgggc caacaacacc      2520
     accacgcagc ccttgttcgt cggccgcggc gcgaacatgc cgtacgacat atacgaggcc      2580
     gaggacggca cggtcggcgg cggagccaag gtcgtcggcc cgaaccggac catcggcgac      2640
     ttcgccggcg aggccagcgg ccgcaaggcg gtcaccctcg gcgcgaccgg ccagtacgtc      2700
     gagtggacca cccgcgcggc caccaacacc ctggtgaccc gcttctccat ccccgacggc      2760
     accaacacga cgctgaacgt ctacgtggac ggccagttcc tcaaggcgat cgatctgacc      2820
     tcgaagtacg cctggctgta cggcaacgag accgcccccg gcaactcgcc cggctccggt      2880
     gcgccccgcc acatctacga cgaggcgaac ctgctgctcg gcaagaccgt cccggccggt      2940
     tccaagatca ggctccagaa ggacgcggcc aacacctcca cctacgccat cgacttcatc      3000
     aacaccgagc aggcgaccgc ggcttcgaac ccggacccgg ccgcctatgc ggtcccggcc      3060
     ggcttctcgc agcaggacgt gcagaacgcg ctcgacaagg tccgcatgga cacgacgggc      3120
     aagctcgtcg gtgtctacct gcccgccgga gactacgaga cctccagcaa gttccaggtc      3180
     tacggcaagg cggtcaaggt cgtcggagcc ggaccgtggt tcacccgttt ccacgcgccc      3240
     tcctcgcagg agaacaccga catcggcttc cgggccgacg ccaccgccaa gggctcgacg      3300
     ttcgccggat tcgcctactt cggcaactac acgtcccgca tcgacggccc gggcaaggtg      3360
     ttcgacttcg caggtgtctc cgacatcacc atcgacaaca tctgggtcga gcacatggtg      3420
     tgcctctact ggggcgccaa caccgacaac atgaccattc agaactcccg catccgggac      3480
     atgttcgccg acggcatcaa catgacgaac ggctccacgg acaaccacgt cgtcaacaac      3540
     gacgcccggg ccacgggcga cgacagcttc gccctcttct cggcgatcga cgcgggcgga      3600
     gccgacgaga agaacaacct ctacgagaat ctgacatcca cactcacctg gcgggccgcc      3660
     ggaatcgccg tctacggcgg ctacaacaac accttccgca acatccgcgt cgccgacacc      3720
     ctggtctact ccggcatcac gatctcctcg ctggacttcg gctacccgat gaacggcttc      3780
     gggaccgagc ccacgacgat cgagaacgtc tccctggaaa ggacgggcgg ccacttctgg      3840
     ggctcgcagg tcttcccggc catctgggcg ttctccgcct ccaaggtctt ccagggcatc      3900
     cgcgtcaacg acgtcgacat cgacgactcc acctacggag gcgtgatgtt ccagaccaac      3960
     tacgtcggag gtcagccgca gttcccggtg aaggacacga tcttcaccga tatctccatc      4020
     accaactcca agaagagcgg agacgcgttc gacgccaagt ccgggttcgg catctgggcc      4080
     aacgaactcc cggaacccgg tcagggcccc gccgtcggtg aagccacctt ccgcaacctg      4140
     cggatgagcg gcaacgccca ggacatccgt aacacgacca gcacgttcag gatcaacgtc      4200
     gagtag                                                                 4206
//

If you have problems or comments...

PBIL Back to PBIL home page