(data stored in ACNUC7421 zone)

EMBL: CP002047.PE635

CP002047.PE635       Location/Qualifiers
FT   CDS_pept        complement(819716..821857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00635"
FT                   /product="hypothetical protein"
FT                   /note="COG3828 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03756"
FT                   /db_xref="GOA:D7C2A2"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR026071"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A2"
FT                   /protein_id="ADI03756.1"
FT                   /translation="MFRSLRRTAAAALLALTAALLPSGGIAQAAGADAAYDVLVFSRTT
FT                   GFRHDSIPAGIDALRALGSANDFTVTATEDPAAFTQANLAGYEAVVFLSTTGDVLDDAQ
FT                   QNALQAHIDGGRGFVGVHAAADTEYDWGYYGDLVGARFKSHPAIQQASIVNEDRGHPAT
FT                   AHLGATWTRTDEWYNYQTNPRSSVHVLQSLDETSYSGGEMGDHPITWCHAQGAGRSFYT
FT                   GLGHTAESYADPAFRALLLGALRYASGAASADCSSSSSTTRTVEGEAFSSGSGVQIASH
FT                   APASGGQTLGYVDNGDWAGYSTVPTAGAARFSARVSSAGAGGTIDIRDGSAAGPVLGSV
FT                   TVPGTGGWETFTTVATDVKAGAGPLYLTFRGGSGALFDVDTLTVTYRTTSKALASNVHL
FT                   FYYPWYGSPAVLGSWRHWPQGGHTPPEDIGANYYPALGPYDSGDFTSAVARHMEWVKRS
FT                   GAGVIVYSWWGRDSYEDGLVRGVLDAAAAQGVKVAWHLEPYTGRTAASTVADINYLNNT
FT                   YGSHPAFYRDTAHGNKNAFYIFESLRITDWSPLDQVTDDSIVLAQTTDTTKIAHFSGMY
FT                   TYDGIAGATAPGWKQAGDYAKAHGLIWAPSVAPGYVDDRAVPGNTTPTLARDNGAAYDK
FT                   QWNNALDPQIGGSPTWVSVTSFNEWHEGSVIEPADSSPPAGHGYETYNGAYGRTGADAE
FT                   TAYLDRTAYWTGRFTGAGG"
     atgttcagat ccttacgccg caccgcggcc gcagccttgc tggcgctcac tgccgctctg        60
     ctgccttcgg gcggaatcgc gcaggccgcg ggcgccgacg ccgcgtacga cgtgctcgtc       120
     ttctcccgca ccaccgggtt ccggcacgac tccatcccgg ccggtatcga tgcgctccgg       180
     gccctcggct cggcgaacga cttcacggtc accgccaccg aggaccccgc cgcgttcacc       240
     caagccaacc tggccggcta cgaggcggtc gtcttcctca gcaccacggg cgacgtgctc       300
     gacgacgccc agcagaacgc gctgcaggcg cacatcgacg gcggccgcgg cttcgtcggc       360
     gtccacgcgg ccgccgacac cgagtacgac tgggggtact acggcgacct cgtcggcgcc       420
     cgcttcaaga gccaccccgc cattcagcag gcgagcatcg tcaacgagga ccgcggccac       480
     ccggcgaccg cccacctcgg cgcgacctgg acccgcaccg acgagtggta caactaccag       540
     accaaccccc gctcctcggt gcacgtgctg cagagcctgg acgagacctc gtacagcggc       600
     ggggagatgg gcgaccaccc gatcacctgg tgccatgcgc aaggcgccgg ccgctccttc       660
     tacaccggtc tcggccacac ggccgagtcc tatgctgacc cggccttccg ggcgctgctg       720
     ctgggcgcgc tccggtacgc gtccggtgcg gcgtcggccg actgctcgtc gtcgagcagc       780
     accacacgga cggtggaggg cgaggcattc tcctccggct cgggcgtgca aatcgcgagc       840
     cacgctccgg cgagcggcgg gcagaccctg ggctatgtcg acaacggcga ctgggcgggc       900
     tactccacgg tgccgactgc cggggcggcg cgcttcagcg cccgtgtctc ctcggccggc       960
     gcgggcggca cgatcgacat acgggacggc tccgccgcgg gaccggtcct gggctcggtc      1020
     accgtcccgg gcacgggcgg ctgggagacg ttcacgacgg tggccaccga tgtgaaggcc      1080
     ggggcgggcc cgctgtatct gacgttccgg ggcggatcgg gcgcgctgtt cgacgtggac      1140
     accttgacgg tgacgtaccg caccacctcg aaggcgctcg cctccaacgt ccacctcttc      1200
     tattacccct ggtacggcag ccccgccgtg ctgggcagct ggcgccactg gccgcagggc      1260
     ggccacaccc cgccggagga catcggggcg aactactacc ccgcgctggg cccctacgac      1320
     tccggcgact tcacgtccgc ggtggcccgc cacatggagt gggtgaaacg ctcaggggcc      1380
     ggcgtgatcg tctacagctg gtgggggcgg gactcgtacg aggacgggct ggtgcgcggg      1440
     gtgctcgatg cggcggccgc gcagggtgtg aaggtggcgt ggcatctgga gccgtacacc      1500
     ggccgtacgg cggcctcgac ggtcgccgac atcaactacc tcaacaacac ctacggctcc      1560
     catccggcct tctaccggga cacggcacat ggcaacaaga acgcgtttta catttttgaa      1620
     agcctgagga tcaccgactg gtcgcccctg gaccaggtca ccgacgacag catcgtcctg      1680
     gcgcagacca cggacaccac caagatcgcc cacttctccg ggatgtacac gtacgacggc      1740
     atcgccggcg ccacggcacc gggctggaaa caggccggag actacgcgaa ggcacacggc      1800
     ctgatctggg ccccgtcggt ggcccctggc tacgtggacg accgtgccgt gcccggcaac      1860
     accaccccga cgctggcccg cgacaacggg gcggcgtacg acaagcagtg gaacaacgcc      1920
     ctggacccgc agatcggcgg ctcgccgacc tgggtgtcgg tgacgtcctt caacgaatgg      1980
     cacgagggca gcgtgatcga gcccgccgac agctcgccac cggccggcca cggctacgaa      2040
     acgtacaacg gcgcctacgg ccgcaccgga gcggacgctg aaacggccta cctggaccga      2100
     acggcctact ggacggggag gttcaccggg gcgggcggct ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page