(data stored in ACNUC7421 zone)

EMBL: CP002047.PE636

CP002047.PE636       Location/Qualifiers
FT   CDS_pept        complement(821881..824730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00636"
FT                   /product="Glucose/sorbosone dehydrogenase-like protein"
FT                   /note="COG2133 Glucose/sorbosone dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03757"
FT                   /db_xref="GOA:D7C2A3"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A3"
FT                   /protein_id="ADI03757.1"
FT                   /translation="MPPRLHAVLHVIRPFTCVLALLIGGATAAAVPASAAPASQSAPAA
FT                   IPPSDYQQVQLATGPDELGEPMSLTVLPDRSVLHTARDGTVRITDAVGNTKVAGRLDVY
FT                   THDEEGLQGIAADPGFTTNRYVWVYYSPKLATPAGDAPTTGTAADFERWKGHLNLSRFT
FT                   LKSDGTLDLGSEKVALEVANDRGQCCHVGGDIDFDKDGNLYLTTGDDTNPFESSGYAPL
FT                   DERTDRNPQFDAQRSSGNTNDLRGKLLRIKPTADGGYTIPSGNLFAPGTANTRPEIYAM
FT                   GFRNPFRMSVDKPTGTVYLGDYGPDAGSTDSNRGPSGQVEFDRITGPGNFGWPYCTGTN
FT                   TTTETYTEYTFPSGPSGAKYDCAGGPANNSFRNTGLARLPAAKPSWIRYGGDAGSPPEF
FT                   GTGSESPMGGDVYRYDPNLDSSVKFPQSLDGHYFATEYGRKWIKAITVNGDGSPGSIED
FT                   FPWTGTQIIDSDFGPDGALYVLDYGTGGGNQALYRIEYVGGSNRNPVAEAAADRTSGQA
FT                   PLAVQFSSAGSSDPEGGALTYSWDFGDGSTSTAANPSHTYTANGTYRPTLTVRDPQGLT
FT                   GTASLVVTVGNTAPTVTLRTPGDGTLFTFGDTLPFTIEASDPEDGQVDCAKVKLTYLLG
FT                   HDSHEHQITSTNGCSGSITIPSDGEHDAAANLYGVLDATYTDAGGLTGHNKHILQPRHR
FT                   QAEHFTTQSGIQLASHAPAEGGQTVGFTDDGDWIAFKPYALTKATGITARVASGGAGGT
FT                   LEVRAGAPTGTLLGKATVSVTGGWETYTDVTAQLSGAASGTTELYLVFRGPTGQGNLFD
FT                   LDTFTLTSATSISQTVEGEAYTSGSGVQPAAHTSASGGQTLGYIDNGDSAGYTGVTTEG
FT                   ANSFSAKVSSAGPGGTIQIRSGSATGAVLGSVTVPTTGDWETFTTVGTGLSAGSGPLYL
FT                   TFSGGSGSLFDVDTFTVSR"
     atgcccccac gcctgcatgc cgtactccac gtcatacgcc ccttcacctg cgtgctggcc        60
     ttgctgatcg gcggtgccac cgccgcggcg gtcccggcct cggctgcccc cgcctcgcag       120
     tcggcccccg cggcgatacc gccgagcgac taccagcaag tccagctcgc caccggcccg       180
     gacgaactgg gcgagccgat gtccctgacg gtgctgcccg accgatcggt gctgcacacc       240
     gcccgcgacg gcacggtccg tatcaccgac gccgtcggca acaccaaggt ggcgggcagg       300
     ctcgacgtct acacccacga cgaggagggg ctccagggca tcgccgccga cccgggcttt       360
     accaccaacc gatacgtgtg ggtgtactac tcgcccaagc tcgccacgcc ggcgggtgac       420
     gccccgacca ccggcaccgc cgccgacttc gagcgctgga agggccatct caacctctcc       480
     cgcttcaccc tcaagtccga cggcaccctc gacctgggca gcgagaaggt ggccctggag       540
     gtggccaacg accgcgggca gtgctgtcac gtcggcggcg acatcgactt cgacaaggac       600
     ggcaacctct acctgaccac cggggacgac accaacccct tcgaatccag cggctacgcc       660
     ccgctcgacg aacgcacgga cagaaacccc cagttcgacg cccagcggtc ctccggcaac       720
     accaacgacc tgcgcggcaa gctgctgcgg atcaagccca ccgcggacgg cggctacacc       780
     atcccgtccg gcaacctctt cgcgcccggc accgcgaaca cccgcccgga gatctacgcg       840
     atgggcttcc gcaacccgtt ccggatgtcc gtcgacaagc ccaccggcac cgtctacctc       900
     ggcgactacg gcccggacgc gggctccacg gacagcaacc gcggccccag cggccaggtc       960
     gagttcgacc ggatcaccgg cccgggcaac ttcggctggc cgtactgcac gggaacgaac      1020
     accaccaccg agacctacac cgagtacacc ttccccagcg gcccgtcggg cgccaagtac      1080
     gactgcgccg gcggaccggc gaacaactcg ttccgcaaca ccggactggc caggctgccc      1140
     gccgcgaagc ccagctggat ccgctatggc ggcgacgccg gctccccgcc ggagttcggc      1200
     accggctcgg aatcacccat gggcggcgac gtctaccgct acgaccccaa cctcgactcc      1260
     tcggtcaagt tcccgcagtc cctcgacggc cactacttcg ccaccgagta cggccgcaaa      1320
     tggatcaagg cgatcaccgt gaacggcgac ggatccccgg gcagcattga ggacttcccc      1380
     tggaccggca cccagatcat cgacagcgac ttcggcccgg acggggcgct ctacgtcctc      1440
     gactacggca ccggcggcgg caaccaggcc ctctaccgca tcgagtacgt gggcggcagc      1500
     aaccgcaacc cagtggccga ggcggcggcc gacaggacct ccgggcaggc tccgctggcc      1560
     gtgcagttct cctccgcggg cagctccgac ccggagggcg gcgcgctcac ctactcctgg      1620
     gacttcggcg acggctcgac gtccacggcc gccaacccct cccacacgta cacggccaac      1680
     ggcacctacc gtcccacgct caccgtacgc gacccgcagg gactcaccgg cacggccagc      1740
     ctcgtcgtga ccgtcggcaa caccgcgccg accgtgaccc tgcgcacccc cggcgacggg      1800
     acgctcttca ccttcggcga caccctgccg ttcaccatcg aggcgagcga ccccgaggac      1860
     gggcaggtgg actgcgccaa ggtgaaactc acctatctcc tcggccatga cagccacgaa      1920
     caccagatca ccagcaccaa cggctgctcc ggatcgatca ccattccgtc cgacggcgaa      1980
     cacgacgcgg ccgcgaacct ctacggcgtc ctcgacgcca cctacaccga cgccggcgga      2040
     ctgaccggcc acaacaagca catcctgcag ccccggcacc ggcaggccga gcacttcacc      2100
     acccagtcag gcatccaact cgcctcccac gcccccgccg agggcgggca gaccgtcggg      2160
     ttcacggacg acggcgactg gatcgccttc aagccatacg cgctcaccaa ggcgaccggc      2220
     atcaccgccc gggtggcctc cggcggtgcc ggcggcaccc tcgaggtacg cgccggggcg      2280
     ccgaccggca cgctgctggg caaggccacc gtgtccgtca ccggaggctg ggagacatac      2340
     accgacgtca ccgcccagct cagcggcgca gcgtcgggca ccaccgagct ctatctggtg      2400
     ttccgcgggc cgaccggcca gggcaacctg ttcgacctgg acaccttcac cctcacctcc      2460
     gccacctcca tcagccagac cgtcgaaggc gaggcgtaca cctccggctc gggcgtgcag      2520
     cccgccgctc acacatcggc cagcggcggg cagaccctcg gctatatcga caacggcgac      2580
     tcggcgggct acaccggcgt caccaccgag ggggccaaca gcttcagcgc caaggtgtcg      2640
     tcggccggcc ccggcggcac catccagatc cgctccggct cggcgaccgg agccgtactc      2700
     ggctcggtca ccgtgccgac gaccggcgac tgggagacgt tcacgacggt cgggaccggc      2760
     ctgagcgccg gctccgggcc gttgtatctg acgttcagcg gtggcagcgg atccctcttc      2820
     gacgtggaca ccttcaccgt gagccgctga                                       2850
//

If you have problems or comments...

PBIL Back to PBIL home page