(data stored in ACNUC7421 zone)

EMBL: CP002047.PE638

CP002047.PE638       Location/Qualifiers
FT   CDS_pept        complement(826279..827157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00638"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03759"
FT                   /db_xref="GOA:D7C2A5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A5"
FT                   /protein_id="ADI03759.1"
FT                   /translation="MDIRQLEYFLAVVDQGGFNRAASALYVSQPSLSQAVRVLERDLGT
FT                   ELFHRIGRRAVLTEAGRALIEPAREAVRSLETARASVAAVHELSEGRLDVAAMPSQAVE
FT                   PLTTLIRSFAERYPGVAVAVKAAFTTRDVIDAVRTGAVELGLLASAGPVPDKEVRSYVL
FT                   GEQRFVLVAAPGSFPGRQVVRSEELAGQRLIVGQPGTGMRAYVDSLRDQGIGFTVAAET
FT                   EHRVALLPLVLAGVGLAVVTESWREIARQTGADVLDIEPATALQVSLVSRRGVLSPAAA
FT                   AFWTTAVPSSP"
     gtggatatcc ggcagttgga gtacttcctg gcggtcgtcg accagggtgg gttcaaccgg        60
     gccgcttcgg cgctgtacgt gtcgcagccg tcgttgtcgc aggccgtgcg ggtgctggag       120
     cgtgatctgg gtacggagct gttccaccgg atcgggcgcc gggcggtgtt gacggaggcg       180
     ggccgggcgc tcatcgagcc ggcccgtgag gcggtacgga gtctggagac ggcgcgggcg       240
     agcgtggcgg cggtgcatga actgagtgag gggcgactgg atgttgcggc gatgccgtcg       300
     caggcggtcg agccgctgac gacgctgatc cggtccttcg ccgagcggta tcccggcgtg       360
     gcggtggcgg tgaaggctgc cttcaccacc cgcgatgtca tcgacgcggt gcggaccggg       420
     gcggtggagc tgggtctgct ggcttccgcc ggcccggtgc cggacaagga ggtccgctcg       480
     tatgtgctgg gtgagcagcg gttcgtgctg gtggctgcgc cgggttcctt ccccggccgg       540
     caggtggtgc gcagtgagga gttggcgggt cagcggctga tcgtggggca gccggggacc       600
     gggatgcggg cgtacgtcga ttccctgcgg gatcagggca tcggcttcac cgtggcggcc       660
     gagaccgagc accgggttgc cctgctgccc ctggtgctgg ccggggtcgg gctcgcggtg       720
     gtgacggagt cctggcggga gatcgcccgg cagacggggg ccgatgtcct ggacatcgaa       780
     cccgcgaccg cgctgcaggt ctcgctcgtc agccgccgtg gcgtcctgtc gccggccgcc       840
     gcggccttct ggacgacggc ggtcccctcc agcccctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page