(data stored in ACNUC7421 zone)

EMBL: CP002047.PE639

CP002047.PE639       Location/Qualifiers
FT   CDS_pept        complement(827353..828012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00639"
FT                   /product="hypothetical protein"
FT                   /note="COG3173 Predicted aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03760"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A6"
FT                   /protein_id="ADI03760.1"
FT                   /translation="MADILRSAGYPAPATELAVQIDHAVVVVQELLPGAKIDDLDHRGL
FT                   EHALELNRLQTGRLADRLDIPPVGLHLSEDGSGYCLHEPLRRHNRRSAALERWITAVGE
FT                   DNPDQLVGYDAVHYDFHPGNMLAAGGAITGIVDWDGAGRGDRRFDLVTLRFGIHAKTCE
FT                   PGISKRLDDVLDAVPGDLLRLAWAHMSLRMVDWAIRHFAPADVEHWLDLAEQRAYQ"
     gtggccgaca ttcttcggtc cgcgggatac cccgcgccgg ccaccgagtt ggcggtccag        60
     atcgaccatg cggtggtcgt tgtgcaagag ctcctgcccg gcgcgaagat cgacgatctg       120
     gaccaccgtg gtctggagca cgccctcgaa ctcaaccggt tgcagaccgg tcgactcgcc       180
     gaccgcctgg atattcctcc ggtcggcctg catctgagtg aggacggttc cggctactgc       240
     ctgcacgaac ctctgcgccg gcacaaccgt cgcagtgccg ccctcgaacg ctggatcacc       300
     gcagttgggg aggacaaccc tgaccagctc gtcggatacg acgcagtgca ctacgacttc       360
     catcctggca acatgttggc cgctggcggt gcgatcactg gcatcgtcga ctgggatggc       420
     gccgggcgag gtgatcgccg attcgacctg gtcacattgc gcttcggcat ccacgcgaag       480
     acctgcgaac cgggtatctc caaacggctt gatgacgtcc tcgatgctgt gcctggcgat       540
     ctcctccgac tcgcttgggc ccatatgagc ctgcgcatgg tcgactgggc catccggcac       600
     tttgctccag ccgatgtcga gcactggctc gacctggccg aacaacgcgc ctaccagtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page