(data stored in ACNUC7421 zone)

EMBL: CP002047.PE64

CP002047.PE64        Location/Qualifiers
FT   CDS_pept        58674..59042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03185"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ4"
FT                   /protein_id="ADI03185.1"
FT                   /translation="MNINLSAVIIDAADLEPESAFWHRLLSGSIVKTATHHFLRIDGFP
FT                   VFVIQLAPGHVPPQWPKGNSQQMHVDLTTDDLAAADRLALEAGARRLHPTDDVDPASQK
FT                   GGRVYASPAGHPFCLRSG"
     atgaacatca acctcagcgc agtgatcatc gatgccgccg acctggagcc cgagagtgcg        60
     ttctggcacc ggctgctgag cggctcgatc gtgaagaccg caacccacca cttcctccgg       120
     atcgacggat tcccggtgtt cgtgatccag ctggctccgg ggcatgtccc cccgcagtgg       180
     ccaaagggca actcgcagca gatgcacgtc gatctgacga cggacgacct cgcggccgcg       240
     gacaggctgg cgctcgaggc aggtgcacgt cggctgcatc ccactgacga tgtcgacccc       300
     gcctcacaga agggcggccg ggtctacgcc agcccggccg gacatccctt ctgcctccgg       360
     tcgggctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page