(data stored in ACNUC7421 zone)

EMBL: CP002047.PE640

CP002047.PE640       Location/Qualifiers
FT   CDS_pept        complement(828661..829458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00640"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03761"
FT                   /db_xref="GOA:D7C2A7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A7"
FT                   /protein_id="ADI03761.1"
FT                   /translation="MDHEEVLALFDRQMRRDAQPDGPGARVERDGDVVRHVGADHDWNG
FT                   VLWSDLDDATADAAIAAQVRYFGTLGREFEWKAYAHDRPGDLGRRLRSAGFTAEPEEAV
FT                   MVARVQDLPTDIALPEGVRLLPVTDPAGVDLVVDVHEQAFGTSGASLRQRLLTQLAQNS
FT                   ETVSMVVAMAGDLPVCSARMELNPATEFAGLWGGGTVAAWRGRGIYRALVAHRARIAAD
FT                   LGYRYLQVDATDQSRPILQRLGFAILSTTAPYVYQPQHNDREA"
     atggatcacg aagaagtgct cgccctgttc gaccgccaga tgaggcgcga cgcgcagccc        60
     gacggtcccg gagcccgcgt cgagcgtgac ggcgacgtcg tgcggcacgt cggcgcggat       120
     cacgactgga acggcgtcct ctggtcggac ctcgacgatg ctacggcgga tgcggcgatc       180
     gcggcgcagg tgcgctactt cggcacgctg gggcgcgagt tcgagtggaa ggcatacgcc       240
     cacgaccggc ccggcgatct cgggaggcga ctgcggtcgg ccgggttcac agccgagccc       300
     gaggaagcgg tgatggtcgc ccgggtccag gatctgccga ccgacatcgc gctgcccgag       360
     ggcgtccgcc tgctcccggt taccgacccg gcaggagtgg atctcgtagt ggacgtccac       420
     gagcaggcct ttggcaccag cggtgccagt ttgcggcagc ggctgctcac tcaactggcc       480
     cagaactcgg aaacggtcag catggtcgtt gcgatggccg gcgacctgcc cgtctgctca       540
     gcgcggatgg agctgaaccc ggccacggag ttcgcgggcc tttggggcgg cggcactgtg       600
     gctgcctggc gaggccgggg tatctaccgg gccctggttg cccatcgcgc ccggatcgcc       660
     gccgacctcg gctaccgcta ccttcaggtc gacgcgaccg accaaagccg tcccatcctg       720
     caacgactcg ggttcgccat tctgagtacc acggctccat acgtctacca gccccagcac       780
     aacgaccgtg aagcgtaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page