(data stored in ACNUC7421 zone)

EMBL: CP002047.PE642

CP002047.PE642       Location/Qualifiers
FT   CDS_pept        complement(829646..829849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03763"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A9"
FT                   /protein_id="ADI03763.1"
FT                   /translation="MAQSEFADHGVVEVLRAVDALGHPMAVPPVAELRHFDDGLADEFV
FT                   EQGVVGVASGIQPAGRQRRPTA"
     gtggcgcaga gtgaattcgc cgaccacggg gtggtggaag tgctgcgtgc cgtggacgca        60
     ctgggccacc cgatggctgt cccaccagtc gctgaactcc ggcactttga cgacggcctc       120
     gccgatgagt tcgttgagca gggcgtcgtc ggggtggcgt ccggcatcca gcccgcaggt       180
     cggcagcgac ggccgaccgc gtga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page