(data stored in ACNUC7421 zone)

EMBL: CP002047.PE643

CP002047.PE643       Location/Qualifiers
FT   CDS_pept        complement(830117..833563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00643"
FT                   /product="WGR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03764"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2B0"
FT                   /protein_id="ADI03764.1"
FT                   /translation="MPDAGDTGHAEDAAAAPDEDSFTLPAAWRQSLRPRWGGITRYTHA
FT                   PHESALDSWDRRLAAAKEEWTGTVLGGAVPGIAPEPAAAARRYLEGTADPVGAAVLAVV
FT                   TDRGKLLYDHVADAWHLRHGRVFAARATVELFELDREDNLGSTTRPAVLPEGDSPQQLW
FT                   LRRGAADRVRTLLSMADEGQYREVVAALAAHRGGARRRIVVSYLVPGETGWVAECCADP
FT                   GESGREDRVVRAMLFESLNDEEQLRALLRAGGVSAYDGRLATAATVAEGVGPAVAALIA
FT                   EIWRHRTPSYGASAEEQAGILAELPTDEAFELLMAHADDKQVRPALLEAVRRYPVRAAR
FT                   LLAGRAAPAPGRNSFLLGQLLTAHVATHGELLEPRLAQFPPKAAEVVRELLHPAAADAP
FT                   ADALPELLVSPPWTGRRTAPKPRTVKGLVAGEETRMLWQPGEREAWAGAVEEPRRRVRR
FT                   RQNEPYPDVRTVCEQFTDLDNYRLAALFADGPDTYRPLLAQWTPEHMWELVKELKPVAA
FT                   RWAEDALPPLLHAAARQPAVAGGLLLPYRQLEVARLMADWFVRLKSAAATTRAWFARHG
FT                   ADAAALLVPDAAGPAGAARHSAEHALRAIAATHGKDAVLDAAAGHGPEAVAVVRDLLSA
FT                   DRLELALPSRMPEPAAWAAPRLLPRVLLRERTSALPAESVRHLLTMLAISRPGAVYTGV
FT                   EVVKEACDPESLAAFAWSLFEQWRLSGMPAKESWALHALGWLGDDDTVRRLAPVLRNWP
FT                   GEGAHQRAVEGLDVLAAIGSDVALMHLHGVSERVKFKALKTRAKEKIEQVAADLGLSGE
FT                   ELADRLVPDFGLDADGSTVVDYGPRRFTVGFDEQLRPYFLDQDGKRRKDLPKPGAHDDA
FT                   ELAPAERKRFMALKKDVRTVASDQVRRLEGAMVAGRSWTTGEFRELFVSHPLLWHLVRR
FT                   LVWLCIPARASERALYETPAISGAGAATAVTAVTAFRVAEDRTFADVRDEEFSLPNDAS
FT                   VRPAHPLHLGEELTEWEELFADHGILQPFPQLGRAVHRLTDDEAARDRLERFENITVPT
FT                   AKLLGLERRGWERDEPMFAGVQCWLSKQVAKDRWIIVSPSEGFTLGAVDVSTEQSLEFI
FT                   GLSEQPSAWDPPGEPSRLAFAELDPVTASELLADLTELVAR"
     atgccggacg ccggggacac cggacatgcc gaagacgccg cggcggcacc cgacgaggac        60
     tccttcacgc tgcccgccgc ctggcggcag agcctccgcc cgcgctgggg cggcatcacc       120
     cggtacacgc acgcccccca cgagtcggct ctcgactcct gggacaggcg gctcgcggcg       180
     gcgaaggagg agtggaccgg cacggtcctg ggcggggccg tcccgggtat cgcccctgag       240
     ccggcagccg ccgcacgccg ctatctggag gggacggcgg atccggtcgg cgccgcggtc       300
     ctggcggtgg tcaccgaccg cgggaagttg ctgtacgacc acgtcgccga cgcctggcat       360
     ctgcggcacg ggcgggtctt cgcggcccgt gccacggtgg agctgttcga gctcgaccgc       420
     gaggacaacc tgggcagcac caccaggccg gccgtcctgc ccgagggcga ttcgccgcag       480
     cagctgtggt tgcgccgggg cgccgccgac cgggtgcgga cgctgctgtc gatggccgat       540
     gagggccagt accgcgaggt ggtggcggcg ctggccgcgc accgcggcgg tgcgcggcgc       600
     cggattgtgg tgtcgtatct ggtcccgggt gagaccggct gggtcgcgga gtgctgcgcc       660
     gacccggggg agagcggccg ggaggaccgt gtcgtacgtg ccatgctgtt cgagtcgctg       720
     aacgacgagg agcaactgcg cgctctgctg cgggcgggcg gcgtgtccgc ctacgacggc       780
     aggctcgcca ccgcggccac cgtcgccgag ggcgtcggcc cggccgtcgc cgcgctgatc       840
     gccgagatct ggcggcaccg tacgccttcc tacggggcat cggcggaaga acaggcgggc       900
     atcctggcgg agctgccgac ggacgaggcg ttcgagctgc tgatggccca cgcggacgac       960
     aaacaggtgc gtccggcgct gctggaggcg gtgcgccggt atccggtgcg cgcggcccgc      1020
     ctgctggccg gccgggcggc gcccgccccg ggccgcaact ccttcctgct gggccagttg      1080
     ctgaccgcgc atgtcgccac gcacggtgag ctgctggagc cgcggctcgc acagttcccg      1140
     cccaaggccg ccgaggtggt gcgggagctg ctgcacccgg ccgccgccga cgcccccgcc      1200
     gatgcgctgc ccgagctgct ggtgagccca ccgtggacag gcaggcggac ggcgccgaag      1260
     ccgagaaccg tcaaggggct cgtcgccggg gaggagaccc gcatgctgtg gcagcccggc      1320
     gagcgcgagg catgggccgg cgccgtcgag gagcccaggc ggcgggtgcg gcgccggcag      1380
     aacgagccgt atcccgacgt ccgaaccgtg tgcgagcagt tcacggacct cgacaactat      1440
     cgtctggccg ccctgttcgc cgacggcccg gacacgtacc gcccgctgct ggcgcagtgg      1500
     acgcccgagc acatgtggga gctcgtcaaa gagctgaagc cggtggccgc ccgatgggcg      1560
     gaggacgcgc tgccgccgct gctgcacgcc gcggcgcggc agcccgctgt ggccggcggg      1620
     ctgctcctgc cctatcggca gctggaggtc gcgcggctga tggccgactg gttcgtgcgg      1680
     ctgaagtccg ccgcggccac gacccgcgcc tggttcgccc ggcacggcgc ggacgccgcc      1740
     gcgctgctgg tgcccgacgc ggccggtccg gcgggcgccg cccgccacag cgccgagcac      1800
     gcgctgcggg ccatcgccgc cacgcacggc aaggacgccg tactcgacgc ggcggccggt      1860
     cacggtcccg aggcggtcgc ggttgtccgt gacctgctgt cggccgatcg tctggagctc      1920
     gcgctgccgt cgaggatgcc ggagcccgcc gcctgggcgg ccccccggtt actgccgcga      1980
     gtgctgctgc gtgagcggac ctcggcgctg ccggccgagt ccgtgcgcca tctgctcacc      2040
     atgctggcga tctcccggcc gggtgcggtc tatacgggcg tggaggtggt gaaggaggcg      2100
     tgcgatcccg aatcgctggc cgccttcgcc tggtccctgt tcgagcagtg gcggctgtcc      2160
     gggatgccgg ccaaggaaag ctgggcgctg catgccctgg ggtggctcgg cgacgacgac      2220
     acggtgcgcc gactggcacc ggtcctgcgg aactggcccg gcgagggagc acaccagcgg      2280
     gccgtggagg gcctggacgt gctggcggcc atcggcagcg acgtcgccct gatgcatctg      2340
     cacggggtgt ccgagcgggt gaagttcaag gcgctcaaga cgcgcgccaa ggagaagatc      2400
     gagcaggtgg cggctgatct ggggctgtcc ggcgaggaac tcgccgaccg gctggtgccg      2460
     gacttcgggc tggacgccga cggctcgacc gtcgtggact acgggccccg gcgcttcacc      2520
     gtgggcttcg acgagcaatt gcggccgtac ttcctggacc aggacggcaa gcggcgcaag      2580
     gacttgccca agccgggtgc ccacgacgac gccgagctgg cgccggcgga acgcaagcgg      2640
     ttcatggcgc tgaagaagga tgtgcggacg gtggcctcgg accaggtgcg ccggctggag      2700
     ggcgcgatgg tcgcgggccg cagctggacg accggtgagt tccgcgagct gttcgtctcc      2760
     catcccctgc tgtggcatct ggtgcggcgg ctggtgtggc tgtgcatccc ggcccgggct      2820
     tcggagaggg ctctgtacga gaccccggcc atcagcggcg ccggtgcggc gacggcggtg      2880
     acggcggtga cggcgttccg ggtggcggag gaccgcacct tcgccgacgt acgggacgag      2940
     gagttctcgt tgcccaacga cgcctcggtg cgcccggcgc acccgctcca cctcggcgag      3000
     gagctgacgg agtgggagga actcttcgcc gaccacggga tcctgcagcc tttcccgcag      3060
     ctcggccgcg ccgtgcaccg gctcacggac gacgaggcgg cccgcgaccg gttggagcgg      3120
     ttcgagaaca tcaccgtgcc gaccgccaaa ctgctcggcc tggagcggcg cggctgggag      3180
     cgcgacgagc cgatgttcgc gggtgtgcag tgctggctgt ccaagcaagt ggcgaaggac      3240
     cgctggatca tcgtcagtcc gtcggagggg ttcacgctcg gcgccgtcga cgtctccacc      3300
     gagcagtcgc tggaattcat cgggctgtcc gagcagccca gtgcgtggga cccgcccggg      3360
     gagccgtcca ggctcgcctt cgccgaactc gacccggtga ccgcgtccga gctgctcgcc      3420
     gacctgacgg agctggtggc ccggtga                                          3447
//

If you have problems or comments...

PBIL Back to PBIL home page