(data stored in ACNUC7421 zone)

EMBL: CP002047.PE67

CP002047.PE67        Location/Qualifiers
FT   CDS_pept        complement(61081..61947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00067"
FT                   /product="DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03188"
FT                   /db_xref="GOA:D7BUJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ7"
FT                   /protein_id="ADI03188.1"
FT                   /translation="MSSSNAHHSELGAFLKARRTELGPAQVGLPDSAGRRRVKGLRREE
FT                   VALLASISPDYYTRLEQGRRQASEPVLDALARVLRLDDGERAYMFELSGRDAARPRRRA
FT                   TQKVHPQLQRLLDDLPTTPAVVLGRRTDILAWNPMAAALFTDFARIPEGNRNFVRLVFC
FT                   EPAIRTLYPDWDWVAQISLAQLRMEAARDPKDPRLAVLVGELSLQDPDFRRWWGAHHVA
FT                   VQGTGTKTLNHPVVGRLTLDWSFLTCADDPDQQLITLTAEPGTPSHDRLRILASHATQA
FT                   DREGRRS"
     atgagcagca gcaacgcgca ccacagcgaa ctgggcgctt tcctcaaggc gcggcgcacg        60
     gagctgggcc cggcccaggt cgggctgccc gattcggccg gcaggcgcag ggtcaagggg       120
     ctgcgccggg aggaagtggc cttgctggcg tcgatcagcc ccgactacta cacgcgcctg       180
     gagcagggcc gtcgccaggc ttccgaaccg gtgctggacg cccttgcgcg tgttctccgg       240
     ctcgacgacg gcgaacgtgc ctacatgttc gagctgtccg gtcgggacgc tgcccggccc       300
     cgtcggcgcg ccacgcagaa ggtccatcca cagctgcagc ggctgctgga cgacctgccc       360
     accacgccgg ccgtcgtcct gggccggcgc acggacatcc tcgcctggaa ccccatggcc       420
     gccgccctgt tcaccgactt cgcgcggatc ccggaaggga atcgcaactt cgtacggctg       480
     gttttctgcg aaccggccat cagaacgctg tacccggact gggactgggt ggcacagatc       540
     agcctggcgc agctgcgcat ggaggccgcc cgggacccga aagatccacg gctggccgta       600
     ctggtgggcg agctgtcact tcaggacccc gacttccggc ggtggtgggg cgcccatcac       660
     gtcgccgtcc agggcacggg cacgaaaacc ctgaaccatc ccgtcgtcgg ccggctcacc       720
     ctcgactggt cgttcctcac ctgcgccgac gaccccgacc agcagctcat caccctgacc       780
     gccgagcccg gcacacccag ccacgaccgt ctgcgcatcc tcgcttcaca cgccacacag       840
     gccgaccgcg agggacgccg cagctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page