(data stored in ACNUC7421 zone)

EMBL: CP002047.PE68

CP002047.PE68        Location/Qualifiers
FT   CDS_pept        62123..63088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00068"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03189"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ8"
FT                   /protein_id="ADI03189.1"
FT                   /translation="MSAVTALLICTQETQNVKTSVTFPSNNLAVAGILFTPDDHIDGRL
FT                   PAIVISHPGGGVKEQSPSIYAERLAREGFAALVFDAAYQGESEGEPRGMENPFQRAEDI
FT                   KSAVTYLTTRDDIAPDRIGALGICASGGYVPYAAQTDHRIKGIATVSAVDLGSVFREGL
FT                   GRTQDLAVLKAMLDRSGALRTEEARGAAPQLEAWIPDNAEELLETATRQFRETFEYYRT
FT                   PRGYHPRAVQGWVLRSIDLIAQYDSYAMIRLISPRPLLMIAGSEAESAYFSREAIEKAA
FT                   EPKELVVIDGATHIDLYDKDEYVTPAVAKLTEFFGKHLAG"
     gtgtcggcgg tcacagcact tctcatctgc acccaggaga cacagaacgt gaagaccagc        60
     gtcaccttcc ccagcaacaa tctcgccgtc gccgggattc tcttcacccc cgatgaccac       120
     attgacggcc ggttgccggc cattgtcatc tcccatccgg gaggcggcgt gaaggagcaa       180
     agcccgagta tctacgccga gcgcctggcc cgggagggat tcgcagcgct cgtcttcgac       240
     gccgcctacc agggcgagag tgagggcgag ccacgaggca tggagaaccc cttccagcgg       300
     gccgaggaca tcaagtccgc cgtgacctac ctcaccaccc gtgacgacat cgccccggac       360
     cgtatcgggg ctctgggtat ctgcgcgtcc ggcggttacg tcccctacgc cgcgcagacc       420
     gaccaccgca tcaagggcat cgccacggtc agcgccgtcg accttgggtc agtgttccgt       480
     gagggactgg gccgcaccca ggacctggcg gtcctcaagg ccatgctcga ccggtccggt       540
     gcactgcgca ccgaggaagc acgcggcgcg gccccacagc tggaagcatg gattcccgac       600
     aacgcagagg aactgctgga gaccgccacc agacagttcc gggagacatt cgagtactac       660
     cgcaccccgc gcggctacca cccccgcgcg gtccagggat gggtgctgcg cagcatcgac       720
     ctgatcgccc agtacgactc gtacgcaatg atccggctca tctcgccccg tcccctgctg       780
     atgatcgccg gttcggaggc ggagagcgcc tacttcagca gggaagcgat cgagaaggcg       840
     gccgagccca aggaactggt cgtcatcgac ggcgccactc acatcgacct gtacgacaag       900
     gatgaatacg tcacacccgc cgtcgccaaa ctcaccgaat tcttcggcaa gcacctggcc       960
     ggctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page