(data stored in ACNUC7421 zone)

EMBL: CP002047.PE69

CP002047.PE69        Location/Qualifiers
FT   CDS_pept        complement(63342..63842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03190"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ9"
FT                   /protein_id="ADI03190.1"
FT                   /translation="MFLGEFLKAEADSILCAVGGSDGWVGAGQGLGAWCLAGQLGTLVG
FT                   VEGGFQGGDVVGGDAAPGLLEPADGGHLGDDGLQAAVGGSEHDRVSAGTAGYLQSDPVG
FT                   VDFGASANVPARRRSAIWASPHTSWAPPMGGYDTCATRRWALQHLCEPLTRDETGIPPR
FT                   QLP"
     gtgttcttgg gggagttcct gaaggcagaa gccgacagca tcctgtgcgc ggtaggaggc        60
     agcgacggct gggtcggcgc tggccagggc ttgggtgcgt ggtgcctcgc cggtcagctg       120
     ggcacgctcg tcggcgtcga gggcggtttc cagggcggcg atgttgtcgg gggcgacgcg       180
     gcgcctggac tgctcgaacc cgctgatggt gggcacctgg gcgacgacgg ccttcaggcg       240
     gcggtcggtg gctccgagca cgatcgcgtg tccgccggca cagccggata cctacagtcc       300
     gatccggtcg gcgtcgactt cggggcctcg gcgaacgtac cggcgaggcg gaggagcgcc       360
     atctgggcat ccccgcacac atcctgggcg ccgccgatgg gcggttacga cacctgcgcc       420
     acccgacggt gggcacttca gcatctctgc gagccgctca ctcgcgacga gaccggcata       480
     ccgccgcgcc agttgccgta g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page