(data stored in ACNUC7421 zone)

EMBL: CP002047.PE7

CP002047.PE7         Location/Qualifiers
FT   CDS_pept        complement(7419..8045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03128"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV1"
FT                   /protein_id="ADI03128.1"
FT                   /translation="MPIACTAATVNAVCLAEQATVLLPVLVDAHRNGTDHWMTEGYAGY
FT                   NSPERELVLRTFITLAADGSTGPLTAHLRTFAHNANALQQLLHHAATHFTYDARLRAPL
FT                   PSVWPLILTTVLDALDAGTTLYADNSRWAEYAIAALLPTPQLRTADLDPDNTLNRANRD
FT                   WLTPGALGDAAARWLDLTRGEPKAAGALARFARTTPPPGSAPGLT"
     atgccgatcg cctgcaccgc cgccaccgtc aacgccgtct gcctggccga gcaggccacc        60
     gtcctgctcc cagtcttagt ggacgcgcac cgcaacggca ccgaccactg gatgaccgag       120
     ggctacgccg gatacaacag ccccgaacgc gaactcgtcc tccgcacttt catcaccctc       180
     gccgccgacg gcagcaccgg acccctcacc gcgcacctgc gaacgttcgc ccacaacgcc       240
     aatgctctgc agcagctact ccaccatgcc gccacccact tcacctacga cgcccgactg       300
     cgcgccccgc ttccgtccgt gtggccgctg atcctgacca ccgtgctcga cgctctcgac       360
     gcaggtacca ccctgtatgc ggacaacagc cgctgggccg aatacgccat cgccgcgctg       420
     ctgcccaccc cgcaactgcg caccgccgac ctcgaccccg acaacaccct caaccgcgcg       480
     aaccgcgact ggctcacgcc cggcgccctc ggcgacgccg ccgcacgatg gctcgacctg       540
     acccgcggcg aacccaaggc cgccggcgcg ctggcccgct tcgcccgcac cacccctccg       600
     cctggcagcg caccaggcct gacgtag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page