(data stored in ACNUC7421 zone)

EMBL: CP002047.PE70

CP002047.PE70        Location/Qualifiers
FT   CDS_pept        64296..64931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03191"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK0"
FT                   /protein_id="ADI03191.1"
FT                   /translation="MVDTSTDNTNLKSQYAAQITADLERNSTEHERLSTEISALQRQLS
FT                   VLENNRVLLLSMRQTLGGGTAADVPGNTGVSSSEDESSAARESATLPAARKPAKKTNTA
FT                   TGKRKGAESDGSRPKRVRETGVPTLRDLIRDDLIQHGEPRSAAEVTTALTQALPDREIK
FT                   ATVVRSTLESLVAKGQVHRTKQQKSVFYSVTAPDTAAGTSEPSTASAS"
     gtggtggaca cctctaccga taacaccaac ctgaagtccc agtacgcggc acagatcacc        60
     gcagatctcg aacgcaactc caccgagcac gaacgcctca gtaccgaaat ctcggcgctg       120
     caacggcaat tgtcggtgct cgaaaacaac cgggtgctcc tgctcagcat gcgacagacc       180
     ctcggtggcg gaaccgccgc cgacgtgccg gggaacaccg gcgtcagcag ctctgaggat       240
     gagtcgtccg ctgcgcggga gtccgcaaca ctgccggcag cacgcaagcc agcgaagaaa       300
     accaacacgg ccaccggcaa gcggaagggg gcagagtcgg acgggagccg tcccaagcgg       360
     gtgcgagaaa ccggtgtgcc aacactccgg gacctcatcc gtgatgacct catccagcac       420
     ggtgaaccgc gctccgcagc cgaggtcacc actgccctca cccaggctct tccggaccgc       480
     gagatcaagg ccaccgtcgt gcgcagcact ctcgagtcgc tcgtcgccaa ggggcaagta       540
     caccgcacca agcagcagaa gtccgtcttc tactcggtta ccgccccgga cacggccgcc       600
     ggtacgtctg agcccagcac ggcatccgct tcctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page