(data stored in ACNUC7421 zone)

EMBL: CP002047.PE71

CP002047.PE71        Location/Qualifiers
FT   CDS_pept        65648..66004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00071"
FT                   /product="YCII-related protein"
FT                   /note="COG3795 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03192"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK1"
FT                   /protein_id="ADI03192.1"
FT                   /translation="MMRFVLVIHQGTYPLPGTPQAELVSEEDRKAAYADWAAIGKMENV
FT                   TGAPPMGLPKDATTVRVEDGSAVATEGPFDNTSVGGFLVVEAEDLDSAIAIASRVPQAR
FT                   LGGAVEVRPSAKYW"
     atgatgcggt ttgtgttggt gatccaccag ggcacgtatc cgttgccggg cactccgcag        60
     gcggagttgg tgtcggagga ggacaggaag gcggcgtacg ccgactgggc ggcgatcggc       120
     aagatggaga acgtgaccgg tgcgcccccg atggggctgc ccaaggacgc gacgaccgtc       180
     cgtgtggagg acggttcggc tgttgccacc gagggtccgt tcgacaacac ctcggtgggc       240
     gggttcctgg tggtcgaggc cgaggatctg gattccgcga tcgcgatcgc atcccgcgta       300
     ccgcaggcgc gactgggtgg cgcggtcgaa gtacgaccgt ccgccaagta ctggtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page