(data stored in ACNUC7421 zone)

EMBL: CP002047.PE72

CP002047.PE72        Location/Qualifiers
FT   CDS_pept        complement(66045..66149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03193"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK2"
FT                   /protein_id="ADI03193.1"
FT                   /translation="MAFTVTGDKIVRIDVIRNADRVRSLASSVLGQAE"
     atggccttca ccgtcaccgg cgacaagatc gtcaggatcg acgtcatccg caacgccgac        60
     cgcgtccgca gcctcgcgtc cagcgttctc ggccaagccg agtga                       105
//

If you have problems or comments...

PBIL Back to PBIL home page