(data stored in ACNUC7421 zone)

EMBL: CP002047.PE73

CP002047.PE73        Location/Qualifiers
FT   CDS_pept        66175..67035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03194"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK3"
FT                   /protein_id="ADI03194.1"
FT                   /translation="MTSDQHADRAVDQDGTQFATAGRTGLFGHRRRTTDDAWLPGGTEL
FT                   GTLHDIGVEDLDEGVEIGSPRRRVERVDHLPLTREIPIGPGNLRAVDPTPRSAGELPCG
FT                   RGVSVDDVGDLVEGQVEHVVQHERQPFCRGEPFEYDKRRQAHRVGQQCLLLGVGVSSPD
FT                   DRVGQVLDQRVFPAAPSGSQLVQALPRDDGGQPRLGGRPRLLRPGQGGDRWAMRVGTGQ
FT                   TAGRTARHRRSTGHRRLLPAAIALPTTAKTTLVLQFDGKGIVVRPETLRPATLKAHRTR
FT                   PPCGR"
     gtgaccagtg accagcacgc cgaccgtgcc gttgaccagg acgggacgca gttcgccacc        60
     gcggggcgca cgggcctgtt tggccaccgc cgccgcacca cggacgacgc ttggctgccg       120
     ggtggcaccg aactcggtac gctgcacgac atcggggtcg aggacctgga tgagggcgtc       180
     gagatcggca gtccgcgccg ccgcgtagaa cgcgtcgacc accttccgct gacgcgcgag       240
     atcccgatcg ggccggggaa tctccgcgcc gttgacccga cgccgcgctc ggctggcgag       300
     cttccgtgcg gccgtggggt ttcggtcgat gatgtgggcg atctcgtcga agggcaggtc       360
     gaacatgtcg tgcagcacga acgccaaccg ttctgccggg gtgagccgtt cgagtacgac       420
     aagcggcgcc aggcccaccg cgtcggccag cagtgcctcc tgctcggggt cggggtctcc       480
     agcccggacg accgggtcgg gcaggtgctc gaccagcggg tcttcccggc ggcgccgtcg       540
     ggatcgcaac tggtgcaagc actcccgcgc gacgacggtg gtcagccacg tcttggaggc       600
     cgtccgcggc tcctacgacc aggccagggc ggcgatcgat gggcgatgcg ggtaggtact       660
     gggcaaacgg caggccgaac agctcgtcat cgccgcagca caggacatcg acgccttcta       720
     ccggcagcga ttgcgctgcc gacgaccgcc aagaccacct tggtcctgca gttcgacggc       780
     aagggcatcg tggtacggcc cgagaccttg cgacccgcca ccctcaaagc gcaccgcacc       840
     agacctccct gcgggcgatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page