(data stored in ACNUC7421 zone)

EMBL: CP002047.PE74

CP002047.PE74        Location/Qualifiers
FT   CDS_pept        complement(67602..68735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00074"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03195"
FT                   /db_xref="GOA:D7BUK4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK4"
FT                   /protein_id="ADI03195.1"
FT                   /translation="MARLTRAQQQERTRAAVLVAAREEFAEHGYAEAKVDRIAERAELT
FT                   RGAVYSNFTGKRALYLAVLADAAERARARAEPPMESPDSVGRALGTFARVWLERLPLAG
FT                   DTPGSGHLQLRSLSGVLDTEPARTALAELVRFEALLLALALESRPAARGRMVRPAQLAL
FT                   TLLHGAAGLAENAPGVGDPFDLARAAEHLADIALNDDAEPPHLPFIPRAQPAEDPWAAP
FT                   RGLADEITGRAVDLTDDGVVVLLGVSRLSAAEEAVRSARPRDAVTIVVTTSDPAETGRL
FT                   ARLRIADLVACLRRVFAAEELPRPRIVFDDGGTVPAALGRTSVDDLTEIAIRVRDGLIV
FT                   AHAEGRGAGHAVADSGAPHRGRGTTTPSRRDLRTRPE"
     atggcgagac tgacgcgcgc ccagcagcag gagcgcaccc gcgcggcggt gctggtcgcg        60
     gcccgggagg agttcgccga gcacggctac gccgaggcca aggtcgaccg gatcgccgag       120
     cgagccgaac tgaccagggg tgcggtctac tccaacttca ccggcaagcg cgcgctctac       180
     ctcgcagtgc tcgccgacgc cgccgaacgg gccagggccc gcgccgaacc gccgatggaa       240
     tcgcccgact ccgtcgggcg agcgctcggc acattcgccc gggtctggct cgaacgactg       300
     cccctcgccg gcgacacacc aggaagcggg catctccagt tgcgttcgct gtccggagtg       360
     ctcgacaccg agccggccag gaccgcgctg gccgaactcg tccggttcga agccctgctg       420
     ctcgccctgg cactcgagtc gcgccccgcg gcgcgcggca ggatggtgcg accggcccag       480
     ctggcgctga ccctcctcca cggagcggcc ggtctcgcgg agaacgcccc cggggtcggc       540
     gatccgttcg acttggcccg cgccgccgag cacctggccg acatcgccct caacgacgac       600
     gcggagccac cgcacctgcc cttcatcccc cgggcacagc cggccgaaga cccatgggcg       660
     gcaccccggg gcctcgccga cgagatcacc ggccgcgcgg tcgacctcac tgacgacggc       720
     gtggtcgtcc tactgggcgt gagccgcctg tccgcggccg aggaagcggt ccgctcggcc       780
     cggccacgcg acgcggtgac gatcgtcgtc accacgagcg acccggccga gaccggtcga       840
     ctggcccgcc tccgtatcgc cgatctcgtc gcctgcctgc gacgggtgtt cgcagccgag       900
     gaactaccgc ggccgcgcat cgtcttcgac gacggtggca cggttcccgc tgccctcggc       960
     aggacctcgg tcgacgacct caccgagatc gcgatccggg tgcgtgacgg gctgatcgtg      1020
     gcacacgcgg aaggccgcgg cgccggccac gccgtggccg acagcggcgc cccgcaccgt      1080
     ggccgcggca cgacgacgcc gagccggaga gacctgcgga cgaggcctga atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page