(data stored in ACNUC7421 zone)

EMBL: CP002047.PE75

CP002047.PE75        Location/Qualifiers
FT   CDS_pept        68822..68932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03196"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK5"
FT                   /protein_id="ADI03196.1"
FT                   /translation="MDGKGLDVDELAKRFGRTTAVVSVLVRSADAVPAFS"
     atggacggca aggggctcga tgtcgacgaa ctggccaaga ggttcggccg gacaaccgcg        60
     gtggtcagtg tcctcgtcag gagcgccgac gccgtgccgg cgttcagctg a                111
//

If you have problems or comments...

PBIL Back to PBIL home page