(data stored in ACNUC7421 zone)

EMBL: CP002047.PE76

CP002047.PE76        Location/Qualifiers
FT   CDS_pept        69110..69736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03197"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK6"
FT                   /protein_id="ADI03197.1"
FT                   /translation="MTRSETHTTNANLLVLHALRCAGAAGPARLHAFTGLDESDVESEL
FT                   IDLGAEGLVTRMSGDMPCWLLTDTGRAADAERITDELTSANARGAVEAAFDRFLVLNPE
FT                   LLDLCAAWQLRTVDGIMNANDHSDPVYDSRVLDRFADLDRRAAPVCAELSAALPRFGRY
FT                   RDRLAGALDRAASGALEYVTDSTASYHTVWAELHEDLLATLGMRR"
     atgacccggt ccgaaactca cacgacgaac gccaacttgt tggtgctgca tgccctgcgt        60
     tgcgccggcg ccgccggccc cgcccgcctc cacgcgttca cgggactcga cgagtccgat       120
     gtcgagtccg agctcatcga tctcggggcc gagggcctcg tcacgcggat gtccggcgac       180
     atgccctgct ggctgctcac ggataccggc cgcgccgccg acgccgagcg catcaccgac       240
     gaactcacct cggccaacgc ccgcggagcc gttgaggcgg cattcgatcg gtttctcgta       300
     ctcaacccgg aactgctcga cctctgcgcg gcatggcaac tccgcaccgt cgacggcatc       360
     atgaacgcca acgaccacag cgaccccgtc tacgactccc gggtcctcga ccgattcgcc       420
     gatctcgacc gccgcgccgc ccccgtctgt gccgagctgt ccgcggcact gccccgattc       480
     ggccgttacc gcgaccgcct cgccggagcc ctcgatcgcg ccgcctccgg cgcgctggag       540
     tacgtgaccg acagcaccgc ctcgtatcac accgtatggg cggagctgca cgaagacctg       600
     ctcgccaccc tcgggatgcg gcgatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page