(data stored in ACNUC7421 zone)

EMBL: CP002047.PE79

CP002047.PE79        Location/Qualifiers
FT   CDS_pept        72156..73145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03200"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK9"
FT                   /protein_id="ADI03200.1"
FT                   /translation="MTDSTPPPWVDDLFPFPTPPALRTLIDIAWQDAYDFYRENESFDC
FT                   TLLEMHYDFMFDLAKTPRPPDGCDAYPEIDNQDRQLLVPHFATPEFVPFGSLGDGGYIG
FT                   WLVPAPELSRLDHPVALANGHEHGVTLIGTDTRTGLEFMLSRALRRWRQEPDTEPPAGR
FT                   DPDVWLAQNQWRINARVKDRQLADRLAAELRVHPDPDRTFPGSRWNGTAVMQDTEFDIV
FT                   FDVPEGWRHEPGADGIGVLAPADAYNDREPVVYVSSWESSLEPALADAERLLDTGHPAT
FT                   ALLGLKDIFVNAPSGHFADLKPLWARAYRDLGRAEYAERLDLMTPMYQ"
     gtgaccgatt cgacaccgcc gccatgggtt gacgacctct tcccgttccc cactccgccc        60
     gcgctgcgca cgctgatcga catcgcctgg caggacgcgt acgacttcta ccgagaaaac       120
     gagagcttcg actgcaccct gctggaaatg cactacgact tcatgttcga cctggccaag       180
     actccccggc cgcccgatgg ctgcgacgcc tacccggaga tcgacaacca ggatcggcag       240
     ctattggtgc cgcacttcgc cacgccggag ttcgtgccct tcgggtccct cggcgacggc       300
     ggctacatcg gctggctggt acccgcgccg gaactcagca ggctggacca tccggtcgcg       360
     ctggccaacg gccatgaaca cggcgtgacc ctgatcggca cggacacgcg taccggcctg       420
     gagttcatgc tgtcacgggc cctacgacgg tggcgccagg agccggacac ggagcccccg       480
     gcggggcgcg acccagacgt gtggcttgcc cagaaccagt ggcgcatcaa cgcccgcgtc       540
     aaagaccggc aacttgctga ccggctggcc gccgaactcc gcgtacaccc ggacccggat       600
     cgaacctttc ccggttcacg gtggaatggc acggcagtca tgcaggacac cgagttcgac       660
     atcgtgtttg acgtaccgga ggggtggcgg cacgagcccg gcgcggacgg catcggcgtg       720
     ctcgccccag ccgacgccta caacgatcgg gagccggtgg tctacgtcag ctcgtgggag       780
     tcgtcgctcg aaccagcgct ggccgacgct gaacgcctgc tcgacaccgg acacccggcg       840
     accgcgttgc tcgggctcaa ggacatcttc gtcaacgcgc cgagcggcca cttcgccgac       900
     ctcaagccgt tgtgggcgcg agcataccga gacctcggcc gggccgaata cgcggagcgc       960
     ctcgacctga tgacgccgat gtaccagtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page