(data stored in ACNUC7421 zone)

EMBL: CP002047.PE8

CP002047.PE8         Location/Qualifiers
FT   CDS_pept        complement(8057..8422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03129"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV2"
FT                   /protein_id="ADI03129.1"
FT                   /translation="MYPMAASGSAARALPSLLLAPSDHLGIDRDRIEETATALAASPDG
FT                   IRTLFAAGCAPVWEAPCEEEADKGIPCPRHQPLWAAVQAGLGGCRLGPWLSGSRQPEVL
FT                   PPPTPTPCPSYPPPTCS"
     gtgtatccga tggccgcatc cggctcggcc gcccgcgccc tcccctctct cctcctcgcc        60
     ccgtccgacc acctcggcat cgaccgggac cgcatcgagg agaccgccac cgccctggct       120
     gcgtcgccgg acggcatccg caccctcttc gccgccggct gcgcccctgt gtgggaggcc       180
     ccctgcgagg aagaagcgga caagggcatc ccctgcccgc gccaccagcc cctgtgggcc       240
     gccgtccaag caggcctcgg cggctgccgc ctcggccctt ggctgtccgg aagccgtcag       300
     ccggaggtcc tgccgccccc tacaccgaca ccctgcccgt cgtacccgcc gccgacctgc       360
     tcgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page