(data stored in ACNUC7421 zone)

EMBL: CP002047.PE80

CP002047.PE80        Location/Qualifiers
FT   CDS_pept        complement(73188..73970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00080"
FT                   /product="hypothetical protein"
FT                   /note="COG4312 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03201"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL0"
FT                   /protein_id="ADI03201.1"
FT                   /translation="MTTTPNEPTTALPGRPPVVDLATWQAARDELLVREKAHTREGDAL
FT                   AAARRRLPMVELDGTVEVVGPDGPVPFLDLFQGRDELVVYKHMWYDGAPHQGQCEGCTT
FT                   TAWHLKDAAYLNARGVSFAVLTTGRWDEVASYVAFMGYTQPWYSVRGVDVPVGGDMGYL
FT                   TCFLREGDRVFLTYSTTGRGNERVNGSMGLLDMTPYGRGEAWEDNPQDWPQGGSPCWSW
FT                   RSDAEGNATWGPTSRPVPQWTRPGATPVETLGRHSHHH"
     atgacgacca cgccaaacga accgaccacc gcgctgcccg gccgtccgcc tgtcgttgac        60
     ctggccacct ggcaggccgc ccgtgatgag cttctggtcc gcgagaaggc ccacacccgg       120
     gagggcgacg ccctcgccgc ggcccgccgc cggctgccga tggtggagct cgacgggacg       180
     gtcgaggtcg tcggacccga cgggccggtc ccgttcctgg acctgttcca gggccgcgac       240
     gagctcgtgg tctacaagca catgtggtac gacggcgccc cgcaccaggg gcagtgcgag       300
     ggctgcacca ccacggcctg gcacctgaaa gacgccgcct acctcaacgc ccgcggcgtc       360
     tcgttcgccg tcctgaccac gggccgctgg gacgaggtcg cctcctacgt cgcgttcatg       420
     ggctacaccc agccctggta ctcggtgcgc ggcgtggacg tgccggtcgg cggcgacatg       480
     ggttacctca cctgcttcct gcgcgagggc gaccgcgtgt tcctcaccta ctccacgacc       540
     ggccgcggca acgagcgggt caacgggtcc atgggcctgc tcgacatgac gccctacggc       600
     cgcggcgagg catgggagga caacccccag gactggcccc aaggcggcag cccgtgctgg       660
     tcctggcgct cggatgcgga agggaacgca acctggggcc cgaccagccg ccccgtgccc       720
     cagtggaccc gccccggcgc aacccccgta gagaccctcg gccgacacag ccaccaccac       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page