(data stored in ACNUC7421 zone)

EMBL: CP002047.PE85

CP002047.PE85        Location/Qualifiers
FT   CDS_pept        78057..79619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00085"
FT                   /product="secreted protein"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03206"
FT                   /db_xref="GOA:D7BUL5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL5"
FT                   /protein_id="ADI03206.1"
FT                   /translation="MVPIIIVLIILVVLVFITLIKTIQVIPQASAAIVERFGRYTRTLN
FT                   AGLNIVVPFIDSIRNRVDLREQVVPFPPQPVTTQDNLVVSTDTVIYYQVTDARAATYEV
FT                   ASYIQAIEQLTVTTLRNIIGGMDLERTLTSREEINAALRGVLDEATGKWGIRVNRAELK
FT                   AIEPPTSIQGSVERQMRADRDKRAAILQAEGEKQAALLKAETEREVAAILAGGSGATRS
FT                   TPQSPVRASPVPGHQPLLQDDPRRIGRYHLTARLGQGGMGTVYLGRSPGQRLVAVKAIR
FT                   PEFAADPTFRERFAREIDAARRVGGFHTAPVVDADSRGDLPWLATEYIPGPSLHDVLRQ
FT                   QGALPTRTLLTLAVGIAEALEGIHACGIIHRDLKPSNIIVSSTGPRVIDFGIARALDST
FT                   ALTRTNHVVGTQGFLAPEQLTGTSITPAADLYAFGMVLCHAAGATPLTDGESLESALSL
FT                   LPARFVGIITRCLDHNPNGRPTPTEVLEQLSQNDSPTEDWLPPPVRTMVDLHNAPTAAE
FT                   PGR"
     gtggtaccga tcatcatcgt cctgatcatc ctggtagtgc tcgtcttcat cacactcatc        60
     aagacgatcc aggtcatccc gcaggcgagc gccgccatcg tcgagcgctt cggccgctac       120
     acccgcaccc tcaacgcggg cctcaacatc gtcgtgccgt tcatcgactc gatccgcaac       180
     cgcgtcgacc tgcgtgagca ggtcgtgccg ttcccgccgc agccggtgac cacccaggac       240
     aacctggtcg tgagcaccga caccgtcatc tactaccagg tgaccgacgc ccgcgccgcc       300
     acctacgagg tcgccagcta catccaggcg atcgagcagc tgaccgtcac caccctgcgg       360
     aacatcatcg gtggcatgga cctggagcgc accctgacct cccgcgagga gatcaacgcg       420
     gcgctgcgcg gtgtgctcga cgaggccacc ggcaagtggg gcatccgcgt caaccgcgcc       480
     gaactcaaag ccatcgagcc acccacctcc atccagggct cggtggagag gcagatgcgc       540
     gccgaccgcg acaagcgcgc cgcgatcctc caggccgaag gcgagaagca ggccgcgctg       600
     ctgaaagcgg agaccgaacg cgaagtggcc gccatcctcg ccggcggaag cggagcgacg       660
     cgaagcacac cgcagtcgcc cgtccgggcc agtcccgtcc ccggacacca gccactgctg       720
     caggacgatc cccgccgtat cggccgttac cacctgacgg ctcggttggg ccaaggaggg       780
     atggggacgg tctatctggg ccggtctccc gggcagcgcc tggtcgcggt caaagccatc       840
     cggccggagt tcgccgcgga ccccacgttc cgggaacgct tcgcccgcga gatcgatgcc       900
     gcacgccgtg tcggcggatt ccacaccgcg ccggtggtcg acgccgactc ccgcggcgac       960
     ctgccctggc tggccaccga gtacatccca ggcccttcac tccacgacgt cctcagacag      1020
     cagggtgccc tgcccacgag gacccttctc actctcgccg tcggcatcgc cgaggcactt      1080
     gagggcatcc atgcctgcgg catcatccac cgtgacctca aaccaagcaa catcatcgtt      1140
     tccagtacgg gccctcgcgt catcgacttc ggcatcgccc gagccctcga cagcaccgca      1200
     ctcacccgta ccaaccatgt cgtcggcaca caggggttcc tcgccccgga acagctcact      1260
     ggcacatcga tcacgcccgc cgcggacctc tacgcctttg gcatggtgct gtgccacgcc      1320
     gccggagcca cgccgctcac agacggcgaa tccctggagt cagccctcag tctgctgccg      1380
     gctcgcttcg tcggcattat cacccgatgc ctcgaccaca acccgaacgg ccgtccaacg      1440
     cccaccgagg tactcgagca actctcccag aacgactccc cgaccgaaga ctggctaccg      1500
     cctcccgtac gcacgatggt cgacctgcac aacgccccaa ccgccgcgga gcccggccgc      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page