(data stored in ACNUC7421 zone)

EMBL: CP002047.PE86

CP002047.PE86        Location/Qualifiers
FT   CDS_pept        complement(79551..80450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00086"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03207"
FT                   /db_xref="GOA:D7BUL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL6"
FT                   /protein_id="ADI03207.1"
FT                   /translation="MDDLETRELRYFVAVAEELHFGRAAGRLGIAQPPLSRAIRRLEQR
FT                   LGVQLLDRDRRGAALTEAGRVLLREARVALDAVAAAARRTRRAGDPKRPLVLATKTGAS
FT                   HELLRRLLDTLASEPGAAPIEVLLCEVGEQARLLRDGQADVALMHRPFDDLAGFDTEDL
FT                   RVEGQVAILPAGHPLASCHQLTLADVSNVPHLPIARWPRLDGSYPDGPGPEVHTQSQLA
FT                   QLVALGKTLLVIPASSRAWQWPEHVAVPVVDAPKVTTVIAWPQSSRSQEVASLVRSAAG
FT                   LRGGWGVVQVDHRAYGRR"
     gtggacgatc tcgagacccg cgagctccgg tacttcgtcg ccgtcgccga ggaattgcac        60
     tttggacgcg ccgccggtcg gctcgggatc gcacaaccgc cgctctcgcg cgcgatccgc       120
     cggctggagc agcggctcgg agtccagctc cttgaccggg accgtcgtgg cgcggcgctc       180
     accgaggccg gcagggtgct acttcgggag gccagagtgg cccttgacgc ggtcgcggcc       240
     gctgcgcgtc ggacgcggcg tgccggagat ccgaagcggc cgctggtgct cgcgacgaag       300
     accggggcgt cccatgaact gctgcgacgg ctcctcgaca cgcttgcgag cgaacccggg       360
     gcggcaccga ttgaggtcct cctgtgcgag gtcggcgagc aggcacggct gctccgcgac       420
     gggcaggccg acgtggcact catgcatcgc ccgttcgacg acctcgccgg gttcgacacc       480
     gaagacctcc gcgtcgaagg ccaggtcgcg atccttcccg cggggcatcc gctcgcgtca       540
     tgtcatcagc tcacgctggc ggatgtcagc aacgtgccgc acttgccgat cgctcggtgg       600
     ccccggctcg acgggtccta cccggacggg cccggaccgg aggtgcacac ccagtcgcag       660
     ctcgctcagc tcgtggcgct cggcaaaacg ctgctcgtca tccctgcctc cagccgtgcc       720
     tggcagtggc ccgaacacgt cgcggtgccc gtcgtcgacg cgccgaaagt caccacggtg       780
     atcgcatggc cgcagagcag ccgctcccag gaggttgcct cactcgtccg ctcagcggcc       840
     gggctccgcg gcggttgggg cgttgtgcag gtcgaccatc gtgcgtacgg gaggcggtag       900
//

If you have problems or comments...

PBIL Back to PBIL home page