(data stored in ACNUC7421 zone)

EMBL: CP002047.PE88

CP002047.PE88        Location/Qualifiers
FT   CDS_pept        81393..81776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03209"
FT                   /db_xref="GOA:D7BUL8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL8"
FT                   /protein_id="ADI03209.1"
FT                   /translation="MFTSLATEWPWLLAVIALVIHCSAMAKWVPIQRFWTVYPFIWVLC
FT                   GVGAVAIGSSQGFALTDMLVLCSFALVGLTIGLFPTRKLFVMWAHEINRGEQQESYPYP
FT                   RSHLAFCGVSVIVAVLAAFLLVQ"
     gtgttcacgt cgcttgccac ggagtggccg tggctcttgg ctgtcatagc cctcgtaatc        60
     cactgctccg ccatggccaa atgggtgcca attcagagat tctggacggt gtaccccttc       120
     atatgggtgt tgtgtggtgt cggagcagtg gctatcggtt cgtcgcaggg cttcgccctg       180
     accgacatgc tcgtcctgtg ttcattcgcc ctcgtcgggc tgacaatcgg cctgttcccg       240
     acgcgcaagc tgtttgtgat gtgggcccac gagatcaaca ggggcgagca acaggaaagt       300
     tacccctatc cgcgctcgca cctcgcattc tgcggcgtct ccgtgatcgt cgcggtgctc       360
     gccgcgtttc tgctggtgca gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page