(data stored in ACNUC7421 zone)

EMBL: CP002047.PE90

CP002047.PE90        Location/Qualifiers
FT   CDS_pept        complement(82398..83000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00090"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 2"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03211"
FT                   /db_xref="GOA:D7BUM0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM0"
FT                   /protein_id="ADI03211.1"
FT                   /translation="MGSYTVPYVIERTAQGERSYDVFSRLLNERIIFLGTEIDDGVANV
FT                   VIAQLLHLESANPEREISIYLNSPGGSFTSLMAIYDTMTFVQAPISTFCVGQAASTAAV
FT                   LLAGGDPGRRFVLQHARVLLGQPASGGRQGTVSDLSLAAKEMVRIRSQVEEVLSRHTHH
FT                   DVATLRADMDRDKVLTAEEAVAYGLADEVLSRRLAFV"
     atggggtcgt acacggttcc ctacgtcatc gagcggaccg cgcagggcga gcggtcctac        60
     gacgtcttca gcaggctgct gaacgagcgg atcatcttcc tcggcaccga gatcgacgac       120
     ggggtcgcca atgtggtcat cgcgcaactc ctgcatctgg agtcggcgaa cccggagcgc       180
     gagatctcga tctatctcaa ctcgcccggc ggatcgttca cttcgctgat ggcgatctac       240
     gacacgatga cgttcgtgca agcgccgatc tccacgttct gcgtcggtca ggcggcgtcg       300
     acggcggcgg tgctgctggc cggcggagat cccgggcgac ggttcgtgct ccagcacgcg       360
     cgggtgctgc tcggccagcc ggccagcggc ggccggcagg ggacggtctc cgacctcagc       420
     ctcgcggcca aggagatggt ccgcatccgc tcgcaggtgg aggaggtcct gtcccggcac       480
     acgcatcacg acgtggcgac gctgcgcgcg gacatggacc gggacaaggt gctcactgcc       540
     gaggaggccg tcgcctacgg gctcgccgac gaggtgctga gccgacggct cgcgttcgtc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page