(data stored in ACNUC7421 zone)

EMBL: CP002047.PE91

CP002047.PE91        Location/Qualifiers
FT   CDS_pept        complement(83002..83640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00091"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03212"
FT                   /db_xref="GOA:D7BUM1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM1"
FT                   /protein_id="ADI03212.1"
FT                   /translation="MTSLTTLPPRAEEGDTPPSRFDDHLAAQLLAQRIVLLGTQVDDVS
FT                   ANRVCAQLLLLSAEDPRTDISLYINSPGGSVTAGLAIYDTMRLIPNDVSTLAMGFAASM
FT                   GQFLLTVGTPGKRFALPNARIMMHQPSAGIGGTAADIEIQAENLQFTKEAIERITAEHT
FT                   GQSEETIARDGDRDRWFTAEQAREYGIVDRVVESVADIRPAASRRRMGL"
     atgacttcac tcaccacgct tccgccccgc gcggaggagg gcgacacacc gcccagccgc        60
     ttcgacgacc atctcgcggc acaactgctc gcccagcgga tcgtcctcct cggcacacag       120
     gtcgacgacg tgtcggccaa ccgggtgtgc gcgcaactgc tgctgctgtc ggcggaggac       180
     ccgcgcaccg acatcagcct gtacatcaac agccccggcg ggtcggtcac cgcgggtctc       240
     gccatctacg acaccatgcg gctcatcccg aacgacgtct cgacgctggc gatggggttc       300
     gccgccagca tgggccagtt cctgctcacg gtggggacac ccggcaagcg gttcgcgctg       360
     ccgaatgcgc ggatcatgat gcaccagccc tcagcgggca ttggtggcac cgccgcggac       420
     atcgagatcc aggcggagaa cctccagttc accaaggagg ccatcgaacg gatcaccgcc       480
     gagcacaccg ggcagagcga ggagacgatc gcgcgggacg gcgaccggga ccgctggttc       540
     acggccgagc aggccaggga gtacgggatc gtggaccggg tggtggagtc ggtcgccgac       600
     atccgcccgg ccgcgtcgcg ccgacggatg gggttgtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page