(data stored in ACNUC7421 zone)

EMBL: CP002047.PE92

CP002047.PE92        Location/Qualifiers
FT   CDS_pept        complement(84060..84326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00092"
FT                   /product="hypothetical protein"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03213"
FT                   /db_xref="GOA:D7BUM2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM2"
FT                   /protein_id="ADI03213.1"
FT                   /translation="MCNAAVRPDAYEAAFSALAHPARRRVLLTAYFNGGSMAAGEIAAM
FT                   FAHSWQTTTRHLQVLEVAGLLSSERQGRSRIYRLQRRRQCGSR"
     ttgtgcaatg ccgctgtccg gcccgacgcc tacgaggcgg cgttcagcgc gttggcgcac        60
     ccggcgcggc ggcgtgtcct gctgaccgcc tacttcaacg gcggatccat ggcggccggt       120
     gagattgctg cgatgttcgc gcactcctgg cagacgacca ccagacacct gcaggtcctg       180
     gaggtcgccg gcctgctcag cagcgagcgc cagggccgtt cgcgcatcta ccgcctgcaa       240
     cgacgtcggc agtgtggaag tcggtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page