(data stored in ACNUC7421 zone)

EMBL: CP002047.PE94

CP002047.PE94        Location/Qualifiers
FT   CDS_pept        85202..85762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00094"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03215"
FT                   /db_xref="GOA:D7BUM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM4"
FT                   /protein_id="ADI03215.1"
FT                   /translation="MSAPARRTDAAQNRTRIVEAARAALAESNHVHLNEIAKRAGVGQG
FT                   TLYRNFPNREALLAEVYRRDVEELVTAASALLAEHEPVEALRQWLDRVIDYAEIKRGVL
FT                   AALEPTAWQDLVAHSHNPIESALGHLLDAGKTAGSIRTDVDAPGVLLLIAYLSRLDRGE
FT                   WESMARPLMNVILDGLRRQDTDR"
     atgagcgcgc cagcacgccg tacggatgcg gcgcagaacc ggacccgcat cgtggaggcc        60
     gcccgggcag ccctcgccga gtccaaccac gtccacctca acgagatcgc caagcgcgcc       120
     ggtgtaggac agggaacgct ctaccggaac ttccccaacc gcgaagcgct cctcgccgag       180
     gtctaccggc gcgacgtcga agagctcgtg accgccgcct ccgccctgct ggcggaacac       240
     gagcccgtgg aagccttgcg ccaatggctc gaccgagtga tcgactacgc cgagatcaag       300
     cgcggcgtcc tggcagcgct cgagccgacg gcgtggcagg accttgtcgc ccacagccac       360
     aaccccatcg aaagcgccct cggtcacctg ctggacgcgg ggaaaacggc cggttccatc       420
     cgcacggacg tggatgcccc cggggtcctc ctgctcatcg cctacctcag ccgactggac       480
     cggggtgagt gggaatcaat ggcacggcct ctgatgaacg tcatcctcga cggccttcgc       540
     cgacaggaca cggaccgttg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page