(data stored in ACNUC7421 zone)

EMBL: CP002047.PE95

CP002047.PE95        Location/Qualifiers
FT   CDS_pept        complement(86012..86857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00095"
FT                   /product="putative binding-protein-dependent transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03216"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM5"
FT                   /protein_id="ADI03216.1"
FT                   /translation="MGEYHSVVARTAAARADALGLPFLCSSAVLDALTEQPTDWVARLA
FT                   PAQSHGWRIYADFLLGAGHSRIAVSAEPSVYWASGARILRDYLAPRGGTVIELDMRALA
FT                   PTAVCDELVDNRATALLLLVGHPEPAVSIVKSVRRDQRLAEIMIGAPAGQPEFAEWATL
FT                   LGDDGAAISFLRYLPERLSPLGVRVETALRERLAEAPSFVAFEGYDTVAVLAEVLRSHG
FT                   ADRARIAESWSRVAVEGTRGQIQFSRTPGISVWQWAWTPVQVVDRDPAEPDRFRILHTG
FT                   "
     gtgggggagt atcacagcgt tgtcgctcgc accgctgctg ccagggccga cgccctcggc        60
     ctgccgttcc tctgctcgtc ggcggttctc gacgcgctca ccgaacagcc aacggattgg       120
     gtcgcgcgcc tcgccccggc gcagtcccac ggctggcgga tctacgcaga tttccttctc       180
     ggcgcgggcc acagccgaat cgcggtatca gccgagccga gtgtctactg ggcatccggt       240
     gcccgtattc tgcgggacta cctcgctcca cgcggcggca ccgtcatcga actcgacatg       300
     cgcgcgctcg cccccacggc ggtgtgcgac gaactcgtcg acaatcgcgc gactgccctt       360
     cttctgctgg tcggccaccc ggagccggca gtgtcgatcg tcaagtccgt ccgccgcgac       420
     cagcgcctcg ccgagatcat gattggtgct ccggccgggc aaccggagtt cgccgaatgg       480
     gcgacgttgc tgggcgacga cggtgccgcg atctcgttct tgcgctacct gcccgagcgc       540
     ctcagcccac tcggtgtgcg agtcgagacg gccctgcgcg agcggctggc cgaagcgccc       600
     tccttcgtcg ccttcgaggg ctacgacacg gttgccgtcc tcgccgaggt gctgcgttct       660
     catggcgcgg accgggcgcg cattgccgaa tcctggtcgc gcgttgcagt ggagggcacc       720
     cgcgggcaga ttcagttctc ccgcacgccg ggcatcagcg tttggcaatg ggcttggacg       780
     ccagtccaag tcgttgatcg agatccggcg gaacccgatc gctttcggat cctccacacc       840
     ggctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page