(data stored in ACNUC7421 zone)

EMBL: CP002047.PE96

CP002047.PE96        Location/Qualifiers
FT   CDS_pept        86843..87079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03217"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM6"
FT                   /protein_id="ADI03217.1"
FT                   /translation="MILPHQSSHAQAGQFIYGRRGPLWISRGVSDHQLEWCSDDPAGVI
FT                   DFANGQLESSEQVPARLDPARSSQRNESADPDG"
     gtgatactcc cccaccaaag cagccacgcc caggccggcc aattcatcta cggccgccgc        60
     ggccctctgt ggatcagccg cggtgtctcg gaccaccagc tcgagtggtg ttccgacgat       120
     cccgccggcg tcattgactt cgcgaacggc cagctcgagt ccagcgagca agtgccggcc       180
     cgcctcgacc cagccaggtc gagtcagcgg aacgagagcg ccgatccgga cggatga          237
//

If you have problems or comments...

PBIL Back to PBIL home page