(data stored in ACNUC7421 zone)

EMBL: CP002047.PE97

CP002047.PE97        Location/Qualifiers
FT   CDS_pept        complement(87450..88403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00097"
FT                   /product="hypothetical protein"
FT                   /note="COG0376 Catalase (peroxidase I)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03218"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM7"
FT                   /protein_id="ADI03218.1"
FT                   /translation="MRHALTTGVCGTLVAGALVAAGGILAVPANAAGSGVVYVSPTGRS
FT                   GNPGTQSKPVKTLADVRKVLAARQNPPTVTVLFKGGTYKLPQYRWGNWSAQSVTFKPQP
FT                   RTGTPVFDGAKRQKYWLVVDPTRTKLTFTGLRLSRYTTGGIMLRGTGTADSRRVIGATI
FT                   KGMKFTDMGGAESGYAAVHLNYARNTTITGNTFRNLVNGDCPGCMHAVYFANQSNNNTV
FT                   SGGTFSKISGDAIRAADYSNGNKVRGGSYSRTGTKAVFSAWRLARNTRCSHGNVFYTTA
FT                   RTSKSYRGATIPTVLDGADDSTKPPCTPRAVVRKNP"
     atgcgtcacg ccctcaccac cggagtctgc ggcaccctgg tcgccggagc cctcgtcgcc        60
     gcgggcggca tcctcgccgt accggccaat gccgccggaa gcggtgtggt ctacgtaagc       120
     cccacgggca ggagcggtaa ccccgggaca cagagcaagc ccgtgaagac cctcgccgat       180
     gtgcgtaagg tcctcgccgc acggcagaac ccgccgacgg tgacggtgct cttcaaagga       240
     ggcacctaca agctccccca gtacaggtgg gggaactggt cggcgcagag cgtcacgttc       300
     aagccgcagc ctcgcaccgg aaccccggtc ttcgacggcg cgaagaggca gaagtactgg       360
     ctcgtcgtcg atccgacgag gacgaagctc accttcaccg ggttgaggct cagccgctac       420
     accacgggcg ggatcatgct ccgcggcacc ggtacggccg acagccgaag ggtgatcggt       480
     gccaccatca agggaatgaa gtttacggac atgggcggcg ccgagtcagg ttacgcggcg       540
     gtccatctca actacgcccg gaacaccacg attacgggga acaccttccg caacctcgtg       600
     aacggggact gccccggctg tatgcacgcg gtgtacttcg ccaatcagag caacaacaac       660
     accgtaagcg gcggaacctt ctccaagatc tccggagacg cgatccgggc agccgactac       720
     agcaacggca acaaagtacg gggtggcagc tacagcagga ccggcaccaa ggcggtcttc       780
     tccgcgtggc ggctcgcgcg caacaccagg tgttcgcacg gcaatgtctt ctacaccacg       840
     gccaggactt ccaagagcta caggggtgcg accatcccca ccgtgctgga cggagccgac       900
     gactcgacca agcccccgtg cactccgcgt gccgtcgtac gcaagaaccc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page