(data stored in ACNUC7421 zone)

EMBL: CP002047.PE99

CP002047.PE99        Location/Qualifiers
FT   CDS_pept        complement(90075..90650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00099"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03220"
FT                   /db_xref="GOA:D7BUM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM9"
FT                   /protein_id="ADI03220.1"
FT                   /translation="MRSDTERNRRHLIEAAARLFANSPTPVSLAEIAKEAEVSTATAYR
FT                   HFSSVEEILHAFRRQVGSDLRDFSARQTTRGMAKLEAVSRYWVSLVLEHGGAMAQMRSH
FT                   RGYLERLREGTGYLTPQAEALAEPLRQTAEELDLGELGDEALYLWNALFDPRDILDLIK
FT                   SGRTEDEAATRLVAALRGSLIGWSAAGP"
     atgcgcagtg acaccgagcg caaccgcagg cacctcatcg aggcagccgc gcggctgttc        60
     gcgaactcgc cgacgcccgt cagcctcgcc gagatcgcca aggaagcaga ggtgtccacc       120
     gcgacggcct accgccactt ctcctcggtc gaggagatcc tgcacgcctt ccgccgccaa       180
     gtaggctcgg atctacggga cttcagcgcc cgacagacca cgcggggcat ggcgaaactc       240
     gaggcggtgt cgcggtactg ggtgtccctg gtcctcgaac acggcggcgc gatggcgcag       300
     atgcgctcgc accgcggcta cctggagcgg cttcgcgaag gaaccggcta cctcacccca       360
     caggccgaag cgctcgccga gccactgcgc cagaccgccg aggaacttga cctcggagag       420
     ctcggcgacg aagccctcta cctgtggaac gcgctgttcg acccccggga catcctcgac       480
     ctcatcaaga gcggacgcac cgaggacgag gccgccaccc gcctcgtggc cgcactgcgc       540
     ggctccctga tcggctggtc cgcggcagga ccctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page