(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG1

CP002047.SIG1        Location/Qualifiers
FT   CDS_pept        complement(295419..296336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig1"
FT                   /locus_tag="SBI_00270"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03391"
FT                   /db_xref="GOA:D7BWN5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN5"
FT                   /protein_id="ADI03391.1"
FT                   /translation="MNRSDEPTPDSLEAAAEDFLQLRPRLFGIAYRILGSVDEAEDVVQ
FT                   DAWLRWQGTDRSVVENPGAFLATATTRLAINVAQSARVRRESHVGSWLPEPIDTSMDPH
FT                   VGAERGEALELAVMFLLEKLNPVERAAYVLREAFEYPYDQIANILQLSQANTRQIVSRS
FT                   RKRLSAERREPVDTAELRRLLEAFLAAAATGDIDALEELLSADVVAYADGNGMRGVARV
FT                   AVMGALRVARISTFAKRFIPWDEYRIVEVNGLPALLTAKEGVTTALVTITVGRDGIDGF
FT                   YWILTPEKLRAYERSSHRAVPRRP"
     atgaacaggt cagacgagcc cacccctgac tcgctcgaag cggcggcgga ggacttcctg        60
     cagctgcgac cccggttgtt cggcatcgcc taccgcatcc tgggcagcgt ggacgaggcg       120
     gaggacgtcg tccaggacgc ctggctgcgc tggcagggca ccgaccggag tgtcgtggag       180
     aatccggggg ccttcctggc gacggcgacc acgcggctgg ccatcaacgt ggcccagtcg       240
     gcgcgggtgc ggcgcgagtc acatgtgggg tcgtggctgc ccgagccgat cgacaccagc       300
     atggatccgc acgtcggtgc cgagcgcggc gaggcccttg agctggccgt gatgttcctc       360
     ctggagaaac tgaatcccgt ggagcgggcg gcctatgtgc tgcgcgaggc cttcgagtac       420
     ccgtacgacc agatcgcgaa cattctgcag ctgagccagg ccaacacacg gcagatcgtc       480
     agccggtccc gtaagcgact gtcggccgag cgccgtgaac ccgtcgacac ggcggagctc       540
     cggcgcctgc tggaagcctt cctcgccgcc gcggcgaccg gcgacatcga cgcccttgag       600
     gagctgctgt cggccgacgt cgtcgcctac gcggacggca acggcatgcg gggagtggca       660
     cgggtcgcgg tcatgggcgc tctgcgtgtg gccaggatca gcacattcgc caagaggttc       720
     atcccctggg acgagtaccg cattgtcgaa gtcaacggcc ttcccgctct gttgaccgcc       780
     aaggagggtg tcaccaccgc gctggtgacc atcaccgtgg ggcgggacgg gatcgacggg       840
     ttctactgga tcttgacgcc ggagaagctc cgggcgtacg agcggtcgtc gcaccgagct       900
     gttccgcgcc ggccgtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page