(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG2

CP002047.SIG2        Location/Qualifiers
FT   CDS_pept        399584..400495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig2"
FT                   /locus_tag="SBI_00337"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03458"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD0"
FT                   /protein_id="ADI03458.1"
FT                   /translation="MDHAGDAVPIAELLDERRYLLDVAYWMLGSGGAAESVIDETYRRW
FT                   YGLSDSARARIAVPRSWLAKTAGGICLGRLALPDRGEDTDQGEGGGPYAGDADGARASA
FT                   ELEQEISGVLLNALDSLSPAERAAFVLNEVFGMTPDTVADIVGRTGPECVELADRARRR
FT                   LRARRSRPTTPEQHDTVARTVRHACVTENAGLLASLLWPDATAFFDGGGKVRALARPVH
FT                   GSEHVAHSLMTLLVRRPRTTLTAQSVNGRTGLVARYGDQVAAVISLDIADHRVAQVWVV
FT                   LNPDKLRSWNQPPSAHQRPSQA"
     atggaccatg ccggtgatgc agtgccgatc gcggagctgc tcgatgagcg tcgatatctc        60
     ctggatgtcg cttattggat gctgggcagc ggcggcgcgg cggagagtgt cattgatgag       120
     acctaccgtc ggtggtacgg gctgtcggac tcggcgcgtg cgcggatcgc ggtgccccgc       180
     tcctggcttg ccaagaccgc gggtggcatc tgcctgggcc gcctggccct gccggatcgc       240
     ggcgaggaca cggaccaggg tgaggggggc ggcccgtatg cgggagacgc cgatggcgca       300
     cgggcgagcg cggagctgga gcaggagatc agcggggttc tgctgaatgc tctggactct       360
     ctttcgccgg cggaacgtgc ggcgttcgtg ctcaacgaag tgttcgggat gacgcccgat       420
     acggtcgccg acatcgtggg gcgtacgggg ccggagtgtg tcgaactcgc cgatcgtgcg       480
     cgtcgccgtc ttcgggcgcg acggtcgcgt cccacgacgc cggagcagca tgacacggtc       540
     gcccgtaccg tccgtcacgc ctgtgtgacc gagaacgccg ggctgctggc atccttgctg       600
     tggcctgatg ccacggcgtt cttcgacggc ggtggcaagg tccgtgcgct ggcccgaccc       660
     gtgcacggca gcgaacacgt cgcacacagc ctgatgacac tgctggtccg gcgcccgcgc       720
     accacactga ccgcccagtc cgtcaacggc cggacgggtc tggtggcacg ctacggcgac       780
     caggtggccg cggtcatcag cctcgacatc gccgaccacc gcgtggcaca ggtctgggtc       840
     gtactcaacc ccgacaaact ccgctcctgg aaccaacccc ccagcgcaca ccagaggccg       900
     tcacaggcat ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page