(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG3

CP002047.SIG3        Location/Qualifiers
FT   CDS_pept        complement(400537..401454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig3"
FT                   /locus_tag="SBI_00338"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03459"
FT                   /db_xref="GOA:D7BYD1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD1"
FT                   /protein_id="ADI03459.1"
FT                   /translation="MTFTDHSPLGTTTSALDEAVSVFVQLQPRLFGIAYRVLGSAVEAE
FT                   DVVQEVWLRWQKTDRSAVVSPAAFLSSATTRLAINVAQSARVRRETYIGPWLPEPIDTS
FT                   SDPEVGAQRAEALELALLLVLEKLSPAERAAYVLREAFDYSYPEIADMLQLSVVNVRKI
FT                   VSRARKHLGAEQRESVDAEEHRRLLEAFVGAAQRGDIGSLEALLTPDAVSLSDGNGMRG
FT                   AARIPVLGRARVANLATAYPRFWRGLDLRSVHANGRSGVMIYREGEPKTFLTVAASREG
FT                   IYKVMWLFNPSKIAAFLDSRSRSM"
     gtgaccttca ccgaccacag ccccctcggc accacgacga gcgcccttga cgaggctgtt        60
     tctgtctttg tgcagctcca gcctcgtctt ttcggcatcg cctaccgcgt gctcggcagt       120
     gcggtcgagg ctgaggacgt ggtccaggag gtgtggctgc gctggcagaa gaccgaccgc       180
     tccgcggtgg tcagcccggc ggcctttctg tcgagtgcga cgacccggtt ggccatcaat       240
     gtcgcccagt cggcccgtgt gcgccgggaa acctacatcg ggccgtggtt gcccgagccc       300
     attgatacga gctcggaccc ggaggtgggc gcgcagcggg cggaggcgct ggagctggct       360
     ctgctgctgg tgctggagaa gctgagcccc gcggagcgcg cggcgtatgt actgcgtgag       420
     gcgtttgatt acagctatcc cgagatcgcc gacatgcttc aactcagcgt cgtcaatgtg       480
     cggaagatcg taagccgcgc tcgtaagcac ctgggcgcgg aacagcggga gagcgtggac       540
     gcggaggaac accgacgcct tctggaagcc ttcgtcggcg cagctcagag gggtgacatc       600
     ggctcgttgg aagccctcct caccccggat gccgtcagcc tgtccgatgg caacgggatg       660
     cggggcgctg cgcgcatacc ggttctgggc cgtgcgcggg tggcgaacct ggcgactgcg       720
     tatccgcgat tctggcgtgg cttggatctc cggtctgtcc atgccaacgg gcgttcggga       780
     gtgatgatct accgcgaggg cgagcccaag acgtttctga cggtggctgc ctcgcgggag       840
     ggcatctaca aggtgatgtg gctgttcaac ccgagcaaaa tcgccgcgtt cctcgattca       900
     cgctctcgct ccatgtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page