(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG4

CP002047.SIG4        Location/Qualifiers
FT   CDS_pept        408355..409278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig4"
FT                   /locus_tag="SBI_00347"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03468"
FT                   /db_xref="GOA:D7BYE0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE0"
FT                   /protein_id="ADI03468.1"
FT                   /translation="MSKVEEFEELRPLLFSIAYRILGSVSEAEDAVQETWLRFDGSTTR
FT                   PTSTKAFLSTTVTRISIDVLRSARVRREEYVGPWFPEPLLSDPYEDPARAAELADSVSM
FT                   AALLLLERLSPLERSVFVLREVFAFGFDEIAAAVGRSEAACRQLLVRARRHMEAGRPRF
FT                   EADRQERQELATRFFDALKDGDVGGLRNLLAADAQLVGDGGGKAPQLAKAVIGAENVAR
FT                   VLGTVFPLMIRIDVTFEPHEVNGQSGAIFRDRDGKVLHTLALDVLDGRIQTIRTVINPD
FT                   KLGHLGPVADAWAIDREVKQARRQSN"
     gtgagcaagg tcgaggagtt cgaggagctg cggccgctgc tgttctcgat cgcgtaccgg        60
     attctgggca gcgtgagcga ggccgaggac gcggtgcagg agacgtggct gcgctttgac       120
     ggctcgacga cccggcccac gtcgaccaag gcatttctgt cgaccacggt gacacggatc       180
     tcgatcgatg tgctgcgttc cgcccgggtg cggcgggagg agtacgtcgg accgtggttc       240
     cccgagccgc tgctgagcga tccgtatgag gatccggcgc gggcggcgga gctggccgac       300
     tcggtgtcga tggccgcact gctgctgttg gagcggctca gcccgctgga gcggtcggtg       360
     tttgtgctgc gcgaggtgtt cgccttcggg ttcgacgaga tcgccgcggc ggtggggcgt       420
     tcggaggctg catgccggca gctgctggtg cgcgcgcggc gtcatatgga ggccggacgg       480
     ccgcggttcg aggcggaccg gcaggagcgg caggaactgg cgacgcggtt cttcgacgcc       540
     ctgaaggacg gcgatgtggg cgggctgcgg aatctgctgg ccgccgacgc acaactggtc       600
     ggcgacggcg gcggcaaggc cccgcagctg gccaaggccg tcatcggcgc ggagaacgtg       660
     gcccgggtgc tgggcacggt cttccccttg atgatccgga tcgatgtgac gttcgaaccg       720
     cacgaggtca acggccagtc cggcgccatc ttccgcgacc gggacggcaa ggtgctccac       780
     accctggccc tcgatgtgct cgacgggcgg attcagacca tccgcacggt gatcaacccc       840
     gataagctcg gccacctcgg gccagtcgcc gacgcctggg ccatcgaccg cgaggtgaag       900
     caggcccgtc ggcagtcgaa ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page