(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG5

CP002047.SIG5        Location/Qualifiers
FT   CDS_pept        449956..450534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig5"
FT                   /locus_tag="SBI_00381"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03502"
FT                   /db_xref="GOA:D7BYH4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH4"
FT                   /protein_id="ADI03502.1"
FT                   /translation="MGVADSAWPSEQLVVAAQRGDVDSIAALVSGSHPNVQRFAHSLCA
FT                   TPEDAEDAAQEALIILYRKIGMLRASGALASWMFRIVRNECLRRARTMMRGHPPLPDTA
FT                   VDTAVDSAEDEALRRLDASRVAAAVAALPPDQRRVLIMRDVQGHSGRMVADALGLSTAA
FT                   MKSRLHRARAAVRHTLRTAAPDSPPGGNP"
     gtgggcgtgg ctgactcggc ttggcccagc gaacagctgg tcgtcgccgc gcagcgcggt        60
     gatgtcgact cgatcgccgc gctggtgtcg ggctcacacc cgaacgtgca gcgcttcgcc       120
     cactccctgt gcgcgacccc ggaggacgcc gaggacgcgg cgcaggaagc cttgatcatc       180
     ctgtaccgca agatcggaat gctacgagcc tccggcgcac tggcgtcgtg gatgttccgc       240
     atcgtccgca acgagtgtct gcggcgcgcc cggacgatga tgcggggcca cccgccgttg       300
     ccggacactg ccgtggacac cgccgtggac tcggccgagg acgaggcgct gcggcgcctg       360
     gacgcgagca gggtggcggc ggcggttgcc gcgctgccac ccgaccagcg ccgggtgctg       420
     atcatgcgag atgtgcaggg ccacagcgga cggatggtcg ccgatgcgct gggcctcagt       480
     acggcggcga tgaaatcgcg tctgcaccga gcccgcgcgg cggttcggca cacgctccgt       540
     accgccgcac ctgactcacc tcccggaggg aacccatga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page