(data stored in ACNUC30630 zone)

EMBL: CP002049.PE107

CP002049.PE107       Location/Qualifiers
FT   CDS_pept        complement(126832..127383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0108"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: sru:SRU_0133 thioesterase family protein;
FT                   PFAM: thioesterase superfamily protein; SPTR: Q2S695
FT                   Thioesterase family protein; PFAM: Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13250"
FT                   /db_xref="GOA:D7CXC6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC6"
FT                   /protein_id="ADI13250.1"
FT                   /translation="MRARSPPRAASWDTHPLQSQPLQPVDRSRELCTALVSAPDVRTSP
FT                   SEGESMPTTTRAAETRLVHPVFPSDTNHYHTLFGGQAMAWMDQAAFICATRYCRRRVVT
FT                   VHSSDLSFRRPVPEGSIVELVAQVARTGRTSLEVAVEMWIEPMEREGRELACRGAFTLV
FT                   ALGDDGKPVPVPPLAQRVGA"
     ttgcgcgccc gctcgccgcc gcgcgcggcc agctgggaca cccacccgct gcaatctcaa        60
     ccgctgcaac ccgtcgaccg ctcacgtgag ctgtgcacgg cgctcgtcag cgcgccggac       120
     gttcggacgt ctccgagcga gggggagtct atgcccacaa ccaccagagc cgccgagacg       180
     cggctcgtcc accccgtctt tccaagcgac accaaccact accacaccct cttcggtggt       240
     caggcgatgg cctggatgga ccaagccgcc tttatctgcg ccacccgcta ctgccgccgc       300
     cgggtggtca ccgtgcactc gagcgacctg tcgtttcggc gccccgtccc cgaagggtcg       360
     atcgtcgagc tcgtggcgca ggtcgcgcgc accggccgca cctcgctcga ggtcgccgtc       420
     gagatgtgga tcgaaccgat ggagcgcgag gggcgcgagc tcgcctgccg cggcgccttt       480
     accctggtgg cgctcggtga cgacggcaaa ccggtgccgg tcccgccgct ggcgcaaagg       540
     gtgggggcgt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page